Property Summary

NCBI Gene PubMed Count 8
PubMed Score 34.50
PubTator Score 1.14

Knowledge Summary

Patent (992)

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma -1.100 4.0e-02
interstitial cystitis -1.200 1.4e-04
ovarian cancer 1.200 4.0e-04
psoriasis 1.500 2.8e-03

Gene RIF (2)

AA Sequence

MVAPWRVSVRVCLSHLRCFELRQGLSLLRPSECPRDARLCWLLLGTLPKVVSLCGDVGEGAPDVLSRRRV      1 - 70
RCSGAAGAGPAESLPRAGPLGGVFLHLRLWLRAGALLVKFFPLLLLYPLTYLAPSVSTLWLHLLLKATET     71 - 140
SGPTYIKLGQWASTRRDLFSEAFCAQFSKLHVRVTPHPWTHTERFLRQAFGDDWGSILSFENREPVGSGC    141 - 210
VAQVYKAYANTAFLETDSVQRLGRASCLPPFSHTGAVGGLRELFGYLGNGRKPPENLADQSFLERLLLPK    211 - 280
ADLVGSNAGVSRAQVPGHQPEATNLISVAVKVLHPGLLAQVHMDLLLMKIGSRVLGVLPGIKWLSLPEIV    281 - 350
EEFEKLMVQQIDLRYEAQNLEHFQVNFRNVKAVKFPTPLRPFVTREVLVETYEESVPVSSYQQAGIPVDL    351 - 420
KRKIARLGINMLLKMIFVDNFVHADLHPGNILVQGANGLSSSQEAQLQQADICDTLVVAVPSSLCPLRLV    421 - 490
LLDAGIVAELQAPDLRNFRAVFMAVVMGQGQRVAELILHHARASECRDVEGFKTEMAMLVTQARKNTITL    491 - 560
EKLHVSSLLSSVFKLLMTHKVKLESNFASIVFAIMVLEGLGRSLDPKLDILEAARPFLLTGPVCPP        561 - 626
//

Text Mined References (9)

PMID Year Title