Property Summary

NCBI Gene PubMed Count 8
PubMed Score 32.50
PubTator Score 1.14

Knowledge Summary

Patent (992)

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma -1.100 0.040
psoriasis -1.900 0.000
interstitial cystitis -1.200 0.000
ovarian cancer 1.200 0.000

Gene RIF (2)

PMID Text
25967120 ADCK4-related glomerulopathy is an important novel differential diagnosis in adolescents with SRNS/FSGS and/or CKD of unknown origin
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MVAPWRVSVRVCLSHLRCFELRQGLSLLRPSECPRDARLCWLLLGTLPKVVSLCGDVGEGAPDVLSRRRV      1 - 70
RCSGAAGAGPAESLPRAGPLGGVFLHLRLWLRAGALLVKFFPLLLLYPLTYLAPSVSTLWLHLLLKATET     71 - 140
SGPTYIKLGQWASTRRDLFSEAFCAQFSKLHVRVTPHPWTHTERFLRQAFGDDWGSILSFENREPVGSGC    141 - 210
VAQVYKAYANTAFLETDSVQRLGRASCLPPFSHTGAVGGLRELFGYLGNGRKPPENLADQSFLERLLLPK    211 - 280
ADLVGSNAGVSRAQVPGHQPEATNLISVAVKVLHPGLLAQVHMDLLLMKIGSRVLGVLPGIKWLSLPEIV    281 - 350
EEFEKLMVQQIDLRYEAQNLEHFQVNFRNVKAVKFPTPLRPFVTREVLVETYEESVPVSSYQQAGIPVDL    351 - 420
KRKIARLGINMLLKMIFVDNFVHADLHPGNILVQGANGLSSSQEAQLQQADICDTLVVAVPSSLCPLRLV    421 - 490
LLDAGIVAELQAPDLRNFRAVFMAVVMGQGQRVAELILHHARASECRDVEGFKTEMAMLVTQARKNTITL    491 - 560
EKLHVSSLLSSVFKLLMTHKVKLESNFASIVFAIMVLEGLGRSLDPKLDILEAARPFLLTGPVCPP        561 - 626
//

Text Mined References (9)

PMID Year Title
25967120 2016 ADCK4-Associated Glomerulopathy Causes Adolescence-Onset FSGS.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.