Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.29
PubTator Score 2.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 1.6e-09
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.100 1.6e-09

Gene RIF (2)

AA Sequence

MEIPMGTQGCFSKSLLLSASILVLWMLQGSQAALYIQKIPEQPQKNQDLLLSVQGVPDTFQDFNWYLGEE      1 - 70
TYGGTRLFTYIPGIQRPQRDGSAMGQRDIVGFPNGSMLLRRAQPTDSGTYQVAITINSEWTMKAKTEVQV     71 - 140
AEKNKELPSTHLPTNAGILAATIIGSLAAGALLISCIAYLLVTRNWRGQSHRLPAPRGQGSLSILCSAVS    141 - 210
PVPSVTPSTWMATTEKPELGPAHDAGDNNIYEVMPSPVLLVSPISDTRSINPARPLPTPPHLQAEPENHQ    211 - 280
YQQDLLNPDPAPYCQLVPTS                                                      281 - 300
//

Text Mined References (9)

PMID Year Title