Property Summary

NCBI Gene PubMed Count 41
Grant Count 34
R01 Count 22
Funding $1,941,863.25
PubMed Score 5.33
PubTator Score 71.11

Knowledge Summary

Patent

No data available

Expression

Gene RIF (36)

PMID Text
26459749 Net1 mRNA and protein levels in non-small cell lung cancer tissues were significantly elevated compared with those in their corresponding nontumor tissues.
26456332 AMPK phosphorylation of the RHOA guanine nucleotide exchange factor NET1A inhibits extracellular matrix degradation, an early step in cell invasion
26080853 Simultaneous silencing of NET-1 and survivin using one-chain-double-target siRNA thus provides an advantageous alternative in the development of therapeutics for skin squamous cell carcinoma .
25588829 These data indicate that Net1A acetylation regulates its subcellular localization to impact on RhoA activity and actin cytoskeletal organization.
25486363 Net1A plays a plays a previously unrecognized, Rho GTPase-independent role in controlling ATM activity and downstream signaling after DNA damage to impact cell survival.
25113254 High expression of neuroepithelial transforming gene 1 was associated with hepatocellular carcinoma.
24942521 NET1 was associated with comorbidity of oppositional defiant disorder and symptoms in Attention-deficit/hyperactivity disorder probands
24375299 Data suggests that NET1 may be of prognostic significance in the clinical management of gastric adenocarcinoma
24196235 The overexpression of NET-1 in tumor cells may be closely related to the malignant phenotype of skin squamous cell carcinoma including proliferation, invasion and tumor growth.
23945136 NET1 expression is elevated in OAC and its pre-malignant phenotype, Barrett's oesophagus. NET1 promotes OAC cell invasion and proliferation.
More...

AA Sequence

MEPELAAQKQPRPRRRSRRASGLSTEGATGPSADTSGSELDGRCSLRRGSSFTFLTPGPNWDFTLKRKRR      1 - 70
EKDDDVVSLSSLDLKEPSNKRVRPLARVTSLANLISPVRNGAVRRFGQTIQSFTLRGDHRSPASAQKFSS     71 - 140
RSTVPTPAKRRSSALWSEMLDITMKESLTTREIRRQEAIYEMSRGEQDLIEDLKLARKAYHDPMLKLSIM    141 - 210
SEEELTHIFGDLDSYIPLHEDLLTRIGEATKPDGTVEQIGHILVSWLPRLNAYRGYCSNQLAAKALLDQK    211 - 280
KQDPRVQDFLQRCLESPFSRKLDLWSFLDIPRSRLVKYPLLLKEILKHTPKEHPDVQLLEDAILIIQGVL    281 - 350
SDINLKKGESECQYYIDKLEYLDEKQRDPRIEASKVLLCHGELRSKSGHKLYIFLFQDILVLTRPVTRNE    351 - 420
RHSYQVYRQPIPVQELVLEDLQDGDVRMGGSFRGAFSNSEKAKNIFRIRFHDPSPAQSHTLQANDVFHKQ    421 - 490
QWFNCIRAAIAPFQSAGSPPELQGLPELHEECEGNHPSARKLTAQRRASTVSSVTQVEVDENAYRCGSGM    491 - 560
QMAEDSKSLKTHQTQPGIRRARDKALSGGKRKETLV                                      561 - 596
//

Text Mined References (46)

PMID Year Title
26459749 2015 Neuroepithelial transforming gene 1 functions as a potential prognostic marker for patients with non-small cell lung cancer.
26456332 2015 Identification of AMPK Phosphorylation Sites Reveals a Network of Proteins Involved in Cell Invasion and Facilitates Large-Scale Substrate Prediction.
26080853 2015 Inhibition of skin squamous cell carcinoma proliferation and promote apoptosis by dual silencing of NET-1 and survivin.
25588829 2015 Acetylation of the RhoA GEF Net1A controls its subcellular localization and activity.
25486363 2014 Rho GTPase independent regulation of ATM activation and cell survival by the RhoGEF Net1A.
25113254 2014 A functional and protein-protein interaction analysis of neuroepithelial cell transforming gene 1 in hepatocellular carcinoma.
24942521 2015 The possible involvement of genetic variants of NET1 in the etiology of attention-deficit/hyperactivity disorder comorbid with oppositional defiant disorder.
24375299 2014 Prognostic significance of neuroepithelial transforming gene 1 in adenocarcinoma of the oesophagogastric junction.
24196235 2014 Expression and function of NET-1 in human skin squamous cell carcinoma.
23945136 2013 Expression of neuroepithelial transforming gene 1 is enhanced in oesophageal cancer and mediates an invasive tumour cell phenotype.
More...