Property Summary

NCBI Gene PubMed Count 41
PubMed Score 5.33
PubTator Score 71.11

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 2.23754195782046E-16
lung adenocarcinoma 2714 8.67247874355954E-10
lung cancer 4473 6.22419925239385E-6
pancreatic cancer 2300 1.09311099226694E-5
posterior fossa group B ependymoma 1530 3.06361073497267E-5
cystic fibrosis 1670 1.28362210090501E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00146794813696684
tuberculosis and treatment for 6 months 686 0.00229957543121772
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00284468347239267
glioblastoma 5572 0.00417145276361049
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00606188031638278
fibroadenoma 557 0.0135612066364708
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0142928531761036
subependymal giant cell astrocytoma 2287 0.0169514908259325
medulloblastoma, large-cell 6234 0.0239907198832392
Breast cancer 3099 0.0260299803310367
aldosterone-producing adenoma 664 0.0329871718666599
pancreatic ductal adenocarcinoma liver metastasis 1795 0.045350816970147
Disease Target Count Z-score Confidence
Cancer 2346 0.0 4.0



Accession Q7Z628 Q12773 Q96D82 Q99903 Q9UEN6
Symbols NET1A



4XH9   3EO2  

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid

Gene RIF (36)

26459749 Net1 mRNA and protein levels in non-small cell lung cancer tissues were significantly elevated compared with those in their corresponding nontumor tissues.
26456332 AMPK phosphorylation of the RHOA guanine nucleotide exchange factor NET1A inhibits extracellular matrix degradation, an early step in cell invasion
26080853 Simultaneous silencing of NET-1 and survivin using one-chain-double-target siRNA thus provides an advantageous alternative in the development of therapeutics for skin squamous cell carcinoma .
25588829 These data indicate that Net1A acetylation regulates its subcellular localization to impact on RhoA activity and actin cytoskeletal organization.
25486363 Net1A plays a plays a previously unrecognized, Rho GTPase-independent role in controlling ATM activity and downstream signaling after DNA damage to impact cell survival.
25113254 High expression of neuroepithelial transforming gene 1 was associated with hepatocellular carcinoma.
24942521 NET1 was associated with comorbidity of oppositional defiant disorder and symptoms in Attention-deficit/hyperactivity disorder probands
24375299 Data suggests that NET1 may be of prognostic significance in the clinical management of gastric adenocarcinoma
24196235 The overexpression of NET-1 in tumor cells may be closely related to the malignant phenotype of skin squamous cell carcinoma including proliferation, invasion and tumor growth.
23945136 NET1 expression is elevated in OAC and its pre-malignant phenotype, Barrett's oesophagus. NET1 promotes OAC cell invasion and proliferation.

AA Sequence

QMAEDSKSLKTHQTQPGIRRARDKALSGGKRKETLV                                      561 - 596

Text Mined References (46)

PMID Year Title
26459749 2015 Neuroepithelial transforming gene 1 functions as a potential prognostic marker for patients with non-small cell lung cancer.
26456332 2015 Identification of AMPK Phosphorylation Sites Reveals a Network of Proteins Involved in Cell Invasion and Facilitates Large-Scale Substrate Prediction.
26080853 2015 Inhibition of skin squamous cell carcinoma proliferation and promote apoptosis by dual silencing of NET-1 and survivin.
25588829 2015 Acetylation of the RhoA GEF Net1A controls its subcellular localization and activity.
25486363 2014 Rho GTPase independent regulation of ATM activation and cell survival by the RhoGEF Net1A.
25113254 2014 A functional and protein-protein interaction analysis of neuroepithelial cell transforming gene 1 in hepatocellular carcinoma.
24942521 2015 The possible involvement of genetic variants of NET1 in the etiology of attention-deficit/hyperactivity disorder comorbid with oppositional defiant disorder.
24375299 2014 Prognostic significance of neuroepithelial transforming gene 1 in adenocarcinoma of the oesophagogastric junction.
24196235 2014 Expression and function of NET-1 in human skin squamous cell carcinoma.
23945136 2013 Expression of neuroepithelial transforming gene 1 is enhanced in oesophageal cancer and mediates an invasive tumour cell phenotype.