Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.90
PubTator Score 1.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Rheumatoid Arthritis -1.400 0.046
osteosarcoma -4.479 0.000
glioblastoma 1.100 0.014
interstitial cystitis 2.200 0.001
adult high grade glioma 1.400 0.001
pilocytic astrocytoma 1.100 0.000
primary Sjogren syndrome 2.000 0.002
subependymal giant cell astrocytoma 1.588 0.006
psoriasis 1.300 0.000
invasive ductal carcinoma 1.100 0.019
ulcerative colitis 1.700 0.000
head and neck cancer and chronic obstruc... 1.200 0.003

Synonym

Accession Q7Z614 A8K9D5 Q08E98 Q6P4H2 Q8IV59
Symbols SLIC1

Gene

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18196517 Serves as a sorting molecule that cycles P-selectin ligand protein into endosomes with no impact on leukocyte recruitment.

AA Sequence

MASPEHPGSPGCMGPITQCTARTQQEAPATGPDLPHPGPDGHLDTHSGLSSNSSMTTRELQQYWQNQKCR      1 - 70
WKHVKLLFEIASARIEERKVSKFVVYQIIVIQTGSFDNNKAVLERRYSDFAKLQKALLKTFREEIEDVEF     71 - 140
PRKHLTGNFAEEMICERRRALQEYLGLLYAIRCVRRSREFLDFLTRPELREAFGCLRAGQYPRALELLLR    141 - 210
VLPLQEKLTAHCPAAAVPALCAVLLCHRDLDRPAEAFAAGERALQRLQAREGHRYYAPLLDAMVRLAYAL    211 - 280
GKDFVTLQERLEESQLRRPTPRGITLKELTVREYLH                                      281 - 316
//

Text Mined References (13)

PMID Year Title
25642632 2015 Discovery of six new susceptibility loci and analysis of pleiotropic effects in leprosy.
25416956 2014 A proteome-scale map of the human interactome network.
22412388 2012 A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20018961 2009 Genomewide association study of leprosy.
18196517 2008 SLIC-1/sorting nexin 20: a novel sorting nexin that directs subcellular distribution of PSGL-1.
16782399 2006 The Phox (PX) domain proteins and membrane traffic.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...