Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.31
PubTator Score 1.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma 1.400 5.8e-04
Astrocytoma, Pilocytic 1.100 4.1e-06
glioblastoma 1.100 1.4e-02
head and neck cancer and chronic obstruc... 1.200 2.8e-03
interstitial cystitis 2.200 1.0e-03
invasive ductal carcinoma 1.100 1.9e-02
osteosarcoma -4.479 2.6e-06
primary Sjogren syndrome 2.000 1.8e-03
psoriasis 1.300 7.3e-11
Rheumatoid arthritis -1.400 4.6e-02
subependymal giant cell astrocytoma 1.588 6.1e-03
ulcerative colitis 1.700 4.9e-05

 GO Process (1)

Gene RIF (2)

AA Sequence

MASPEHPGSPGCMGPITQCTARTQQEAPATGPDLPHPGPDGHLDTHSGLSSNSSMTTRELQQYWQNQKCR      1 - 70
WKHVKLLFEIASARIEERKVSKFVVYQIIVIQTGSFDNNKAVLERRYSDFAKLQKALLKTFREEIEDVEF     71 - 140
PRKHLTGNFAEEMICERRRALQEYLGLLYAIRCVRRSREFLDFLTRPELREAFGCLRAGQYPRALELLLR    141 - 210
VLPLQEKLTAHCPAAAVPALCAVLLCHRDLDRPAEAFAAGERALQRLQAREGHRYYAPLLDAMVRLAYAL    211 - 280
GKDFVTLQERLEESQLRRPTPRGITLKELTVREYLH                                      281 - 316
//

Text Mined References (13)

PMID Year Title