Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.61
PubTator Score 0.51

Knowledge Summary

Patent (701)

TINX Plot

  Disease (3)

Disease Target Count P-value
lung carcinoma 2843 6.3e-15
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Osteoporosis 363 0.0 3.0

Expression

  Differential Expression (1)

Disease log2 FC p
lung carcinoma -1.100 6.3e-15

Gene RIF (1)

AA Sequence

MPGHNTSRNSSCDPIVTPHLISLYFIVLIGGLVGVISILFLLVKMNTRSVTTMAVINLVVVHSVFLLTVP      1 - 70
FRLTYLIKKTWMFGLPFCKFVSAMLHIHMYLTFLFYVVILVTRYLIFFKCKDKVEFYRKLHAVAASAGMW     71 - 140
TLVIVIVVPLVVSRYGIHEEYNEEHCFKFHKELAYTYVKIINYMIVIFVIAVAVILLVFQVFIIMLMVQK    141 - 210
LRHSLLSHQEFWAQLKNLFFIGVILVCFLPYQFFRIYYLNVVTHSNACNSKVAFYNEIFLSVTAISCYDL    211 - 280
LLFVFGGSHWFKQKIIGLWNCVLCR                                                 281 - 305
//

Text Mined References (8)

PMID Year Title