Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.59
PubTator Score 0.51

Knowledge Summary

Patent (701)

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Osteoporosis 257 2.0
lung carcinoma 2,844

Expression

  Differential Expression (1)

Disease log2 FC p
lung carcinoma -1.100 0.000

Gene RIF (1)

PMID Text
25672891 GPR141-NME8 locus had strong genetic effect on susceptibility to generalized periodontitis in Japanese individuals with history of smoking. identified suggestive loci for periodontitis in Japanese population.

AA Sequence

MPGHNTSRNSSCDPIVTPHLISLYFIVLIGGLVGVISILFLLVKMNTRSVTTMAVINLVVVHSVFLLTVP      1 - 70
FRLTYLIKKTWMFGLPFCKFVSAMLHIHMYLTFLFYVVILVTRYLIFFKCKDKVEFYRKLHAVAASAGMW     71 - 140
TLVIVIVVPLVVSRYGIHEEYNEEHCFKFHKELAYTYVKIINYMIVIFVIAVAVILLVFQVFIIMLMVQK    141 - 210
LRHSLLSHQEFWAQLKNLFFIGVILVCFLPYQFFRIYYLNVVTHSNACNSKVAFYNEIFLSVTAISCYDL    211 - 280
LLFVFGGSHWFKQKIIGLWNCVLCR                                                 281 - 305
//

Text Mined References (8)

PMID Year Title
25787250 2015 Neomorphic effects of recurrent somatic mutations in Yin Yang 1 in insulin-producing adenomas.
25672891 2015 A genome-wide association study of periodontitis in a Japanese population.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14623098 2003 Seven evolutionarily conserved human rhodopsin G protein-coupled receptors lacking close relatives.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12679517 2003 The G protein-coupled receptor repertoires of human and mouse.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.