Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.45
PubTator Score 1.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
astrocytic glioma 1.500 0.009
ependymoma 1.100 0.036
oligodendroglioma 1.300 0.011
osteosarcoma 3.228 0.000
cystic fibrosis -1.338 0.000
atypical teratoid / rhabdoid tumor 1.600 0.000
glioblastoma 1.500 0.001
group 4 medulloblastoma 1.500 0.001
medulloblastoma, large-cell 1.800 0.000
juvenile dermatomyositis 1.496 0.000
acute quadriplegic myopathy 1.001 0.001
pancreatic ductal adenocarcinoma liver m... -1.457 0.040
intraductal papillary-mucinous neoplasm ... -1.200 0.009
diabetes mellitus -1.700 0.002
pediatric high grade glioma 1.200 0.000
pilocytic astrocytoma 1.100 0.000
spina bifida -1.852 0.043
Pick disease 1.200 0.000
gastric carcinoma 1.500 0.004
ulcerative colitis 1.300 0.000
ovarian cancer 2.600 0.000
pituitary cancer -1.200 0.000

Gene RIF (2)

PMID Text
24156551 KCTD20 is a positive regulator of Akt and may play an important role in regulating the death and growth of some non-nervous and nervous cells.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MNVHRGSDSDRLLRQEASCLVDDTLAVAQEKEANSLASSGPHNLTYPLGPRNEDLSLDYASQPANLQFPH      1 - 70
IMPLAEDIKGSCFQSGNKRNHEPFIAPERFGNSSVGFGSNSHSQAPEKVTLLVDGTRFVVNPQIFTAHPD     71 - 140
TMLGRMFGPGREYNFTRPNEKGEYEIAEGISATVFRTVLDYYKTGIINCPDGISIPDLRDTCDYLCINFD    141 - 210
FNTIRCQDLSALLHELSNDGAHKQFDHYLEELILPIMVGCAKKGERECHIVVLTDEDSVDWDEDHPPPMG    211 - 280
EEYSQILYSSKLYRFFKYIENRDVAKTVLKERGLKNIRIGIEGYPTCKEKIKRRPGGRSEVIYNYVQRPF    281 - 350
IQMSWEKEEGKSRHVDFQCVRSKSLTNLVAAGDDVLEDQEILMHHPPQVDELDRLNAPLSQMASNDFQD     351 - 419
//

Text Mined References (10)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24156551 2013 KCTD20, a relative of BTBD10, is a positive regulator of Akt.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14676191 2004 Comprehensive proteomic analysis of human Par protein complexes reveals an interconnected protein network.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
7829101 1994 Isolation of novel and known genes from a human fetal cochlear cDNA library using subtractive hybridization and differential screening.