Property Summary

NCBI Gene PubMed Count 15
PubMed Score 5.87
PubTator Score 1.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Peripheral Arterial Disease 2 0.0 0.0
Disease Target Count
Peripheral Arterial Diseases 3
Disease Target Count Z-score Confidence
Male infertility 206 3.238 1.6

Expression

Gene RIF (2)

AA Sequence

MAARPGPLWLLGLTLCALGGGGPGLRPPPGCPQRRLGARERRDVQREILAVLGLPGRPRPRAPPAASRLP      1 - 70
ASAPLFMLDLYHAMAGDDDEDGAPAEQRLGRADLVMSFVNMVERDRALGHQEPHWKEFRFDLTQIPAGEA     71 - 140
VTAAEFRIYKVPSIHLLNRTLHVSMFQVVQEQSNRESDLFFLDLQTLRAGDEGWLVLDVTAASDCWLLKR    141 - 210
HKDLGLRLYVETEDGHSVDPGLAGLLGQRAPRSQQPFVVTFFRASPSPIRTPRAVRPLRRRQPKKSNELP    211 - 280
QANRLPGIFDDVRGSHGRQVCRRHELYVSFQDLGWLDWVIAPQGYSAYYCEGECSFPLDSCMNATNHAIL    281 - 350
QSLVHLMKPNAVPKACCAPTKLSATSVLYYDSSNNVILRKHRNMVVKACGCH                      351 - 402
//

Text Mined References (15)

PMID Year Title