Property Summary

NCBI Gene PubMed Count 15
Grant Count 6
R01 Count 5
Funding $134,501.67
PubMed Score 5.34
PubTator Score 1.27

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
20424473 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAARPGPLWLLGLTLCALGGGGPGLRPPPGCPQRRLGARERRDVQREILAVLGLPGRPRPRAPPAASRLP      1 - 70
ASAPLFMLDLYHAMAGDDDEDGAPAEQRLGRADLVMSFVNMVERDRALGHQEPHWKEFRFDLTQIPAGEA     71 - 140
VTAAEFRIYKVPSIHLLNRTLHVSMFQVVQEQSNRESDLFFLDLQTLRAGDEGWLVLDVTAASDCWLLKR    141 - 210
HKDLGLRLYVETEDGHSVDPGLAGLLGQRAPRSQQPFVVTFFRASPSPIRTPRAVRPLRRRQPKKSNELP    211 - 280
QANRLPGIFDDVRGSHGRQVCRRHELYVSFQDLGWLDWVIAPQGYSAYYCEGECSFPLDSCMNATNHAIL    281 - 350
QSLVHLMKPNAVPKACCAPTKLSATSVLYYDSSNNVILRKHRNMVVKACGCH                      351 - 402
//

Text Mined References (15)

PMID Year Title
26496483 2015 Esophageal Cancer Epigenomics and Integrome Analysis of Genome-Wide Methylation and Expression in High Risk Northeast Indian Population.
24692264 2014 Genome-wide copy number variation analysis identifies deletion variants associated with ankylosing spondylitis.
24376796 2013 Comparative gene-expression analysis of the dental follicle and periodontal ligament in humans.
23243014 2013 BMP system expression in GCs from polycystic ovary syndrome women and the in vitro effects of BMP4, BMP6, and BMP7 on GC steroidogenesis.
23109646 2013 Genes that characterize T3-predominant Graves' thyroid tissues.
22579288 2012 BMP8B increases brown adipose tissue thermogenesis through both central and peripheral actions.
22419069 2012 Genome-wide DNA methylation studies suggest distinct DNA methylation patterns in pediatric embryonal and alveolar rhabdomyosarcomas.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19583854 2009 Identifying concerted evolution and gene conversion in mammalian gene pairs lasting over 100 million years.
More...