Property Summary

NCBI Gene PubMed Count 16
PubMed Score 2.93
PubTator Score 1.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (3)

Disease log2 FC p
ependymoma 1.100 3.8e-09
group 3 medulloblastoma 1.900 1.6e-05
pancreatic ductal adenocarcinoma liver m... -1.038 5.4e-04

Gene RIF (7)

AA Sequence

MAVPTELDGGSVKETAAEEESRVLAPGAAPFGNFPHYSRFHPPEQRLRLLPPELLRQLFPESPENGPILG      1 - 70
LDVGCNSGDLSVALYKHFLSLPDGETCSDASREFRLLCCDIDPVLVKRAEKECPFPDALTFITLDFMNQR     71 - 140
TRKVLLSSFLSQFGRSVFDIGFCMSITMWIHLNHGDHGLWEFLAHLSSLCHYLLVEPQPWKCYRAAARRL    141 - 210
RKLGLHDFDHFHSLAIRGDMPNQIVQILTQDHGMELICCFGNTSWDRSLLLFRAKQTIETHPIPESLIEK    211 - 280
GKEKNRLSFQKQ                                                              281 - 292
//

Text Mined References (18)

PMID Year Title