Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.93
PubTator Score 1.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Gene RIF (5)

PMID Text
23063121 BCDIN3D depletion leads to lower pre-miR-145 and concomitantly increased mature miR-145 levels in breast cancer cells, which suppresses their tumorigenic phenotypes.
20816195 Observational study of gene-disease association. (HuGE Navigator)
20724581 Observational study of gene-disease association. (HuGE Navigator)
20712903 Observational study of gene-disease association. (HuGE Navigator)
20215397 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)

AA Sequence

MAVPTELDGGSVKETAAEEESRVLAPGAAPFGNFPHYSRFHPPEQRLRLLPPELLRQLFPESPENGPILG      1 - 70
LDVGCNSGDLSVALYKHFLSLPDGETCSDASREFRLLCCDIDPVLVKRAEKECPFPDALTFITLDFMNQR     71 - 140
TRKVLLSSFLSQFGRSVFDIGFCMSITMWIHLNHGDHGLWEFLAHLSSLCHYLLVEPQPWKCYRAAARRL    141 - 210
RKLGLHDFDHFHSLAIRGDMPNQIVQILTQDHGMELICCFGNTSWDRSLLLFRAKQTIETHPIPESLIEK    211 - 280
GKEKNRLSFQKQ                                                              281 - 292
//

Text Mined References (13)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
23063121 2012 Human RNA methyltransferase BCDIN3D regulates microRNA processing.
20816195 2010 Analyses of shared genetic factors between asthma and obesity in children.
20724581 2010 Genetic susceptibility to obesity and related traits in childhood and adolescence: influence of loci identified by genome-wide association studies.
20712903 2010 Obesity and diabetes genes are associated with being born small for gestational age: results from the Auckland Birthweight Collaborative study.
20215397 2010 Implication of genetic variants near NEGR1, SEC16B, TMEM18, ETV5/DGKG, GNPDA2, LIN7C/BDNF, MTCH2, BCDIN3D/FAIM2, SH2B1, FTO, MC4R, and KCTD15 with obesity and type 2 diabetes in 7705 Chinese.
19557197 2009 NRXN3 is a novel locus for waist circumference: a genome-wide association study from the CHARGE Consortium.
19079260 2009 Genome-wide association yields new sequence variants at seven loci that associate with measures of obesity.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
More...