Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.44
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 5.1896564226374E-23
oligodendroglioma 2849 9.27034459667017E-7
atypical teratoid/rhabdoid tumor 1095 1.78275853256002E-6
pancreatic carcinoma 567 3.99918315798019E-5
pancreatic cancer 2300 3.99918315798029E-5
pilocytic astrocytoma 3086 2.16173243771008E-4
tuberculosis 1563 2.51161364245159E-4
group 3 medulloblastoma 2254 2.69571734902879E-4
pediatric high grade glioma 2712 6.45000068653304E-4
Down syndrome 548 6.72413146003375E-4
medulloblastoma, large-cell 6234 0.00129346195795868
ovarian cancer 8492 0.00178559254824056
interstitial cystitis 2299 0.00281583053268838
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00479242398871991
subependymal giant cell astrocytoma 2287 0.00503888499569159
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00670499108081063
primitive neuroectodermal tumor 3031 0.00814845572398121
glioblastoma 5572 0.0120700533589143
osteosarcoma 7933 0.0147178575773601
lung cancer 4473 0.0163746265255455
progressive supranuclear palsy 674 0.0185376369036463
Pick disease 1893 0.0192254315816762
non primary Sjogren syndrome sicca 840 0.0256400887252843
ependymoma 2514 0.0295868262649348
Endometriosis 535 0.0307749029809971
astrocytic glioma 2241 0.0317342954942543
Rheumatoid Arthritis 1171 0.035146662403916
Disease Target Count Z-score Confidence
Chordoma 5 4.14 2.1

Expression

  Differential Expression (27)

Synonym

Accession Q7Z5S9 D3DP24 Q49A05 Q9NUT3
Symbols

Gene

  Ortholog (13)

AA Sequence

MSNNGADLTFGYISCFVAILLFGSNFVPLKKFDTGDGMFLQWVLCAAIWLVALVVNLILHCPKFWPFAML      1 - 70
GGCIWATGNIAVVPIIKTIGLGLGILIWGSFNALTGWASSRFGWFGLDAEEVSNPLLNYIGAGLSVVSAF     71 - 140
IFLFIKSEIPNNTCSMDTTPLITEHVINTTQDPCSWVDKLSTVHHRIVGCSLAVISGVLYGSTFVPIIYI    141 - 210
KDHSKRNDSIYAGASQYDLDYVFAHFSGIFLTSTVYFLAYCIAMKNSPKLYPEAVLPGFLSGVLWAIATC    211 - 280
CWFIANHSLSAVVSFPIITAGPGFIAAMWGIFMFKEIKGLQNYLLMILAFCIILTGALCTAFSKI         281 - 345
//

Text Mined References (4)

PMID Year Title
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.