Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.44
PubTator Score 0.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
adult high grade glioma -1.200 3.4e-02
astrocytic glioma -3.400 3.2e-02
Astrocytoma, Pilocytic -1.400 7.2e-04
atypical teratoid / rhabdoid tumor -1.200 1.2e-03
Down syndrome 2.700 6.7e-04
Endometriosis -1.246 3.1e-02
ependymoma -3.200 3.7e-02
glioblastoma -1.400 3.0e-02
group 3 medulloblastoma -2.500 2.4e-03
interstitial cystitis -1.300 2.8e-03
intraductal papillary-mucinous adenoma (... 1.400 6.7e-03
intraductal papillary-mucinous neoplasm ... 2.300 4.8e-03
lung cancer -2.000 1.6e-02
lung carcinoma -1.800 5.2e-23
medulloblastoma, large-cell -1.500 3.2e-02
non primary Sjogren syndrome sicca -1.200 2.6e-02
oligodendroglioma -1.800 2.8e-07
osteosarcoma -1.369 1.5e-02
ovarian cancer 1.100 1.8e-03
pancreatic cancer 1.600 4.0e-05
pancreatic carcinoma 1.600 4.0e-05
Pick disease -1.800 1.9e-02
primitive neuroectodermal tumor -1.400 9.7e-03
progressive supranuclear palsy -2.500 1.9e-02
Rheumatoid arthritis 1.200 3.5e-02
subependymal giant cell astrocytoma -2.374 5.0e-03
tuberculosis 1.400 2.5e-04

AA Sequence

MSNNGADLTFGYISCFVAILLFGSNFVPLKKFDTGDGMFLQWVLCAAIWLVALVVNLILHCPKFWPFAML      1 - 70
GGCIWATGNIAVVPIIKTIGLGLGILIWGSFNALTGWASSRFGWFGLDAEEVSNPLLNYIGAGLSVVSAF     71 - 140
IFLFIKSEIPNNTCSMDTTPLITEHVINTTQDPCSWVDKLSTVHHRIVGCSLAVISGVLYGSTFVPIIYI    141 - 210
KDHSKRNDSIYAGASQYDLDYVFAHFSGIFLTSTVYFLAYCIAMKNSPKLYPEAVLPGFLSGVLWAIATC    211 - 280
CWFIANHSLSAVVSFPIITAGPGFIAAMWGIFMFKEIKGLQNYLLMILAFCIILTGALCTAFSKI         281 - 345
//

Text Mined References (4)

PMID Year Title