Property Summary

NCBI Gene PubMed Count 17
Grant Count 33
R01 Count 21
Funding $3,851,009.85
PubMed Score 127.25
PubTator Score 13.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.500 0.000
glioblastoma -1.500 0.000
medulloblastoma -1.300 0.000
medulloblastoma, large-cell -1.500 0.000
primitive neuroectodermal tumor -1.300 0.000
pediatric high grade glioma -1.300 0.000

Gene RIF (15)

PMID Text
27226627 Five x-ray crystal structures of hpol eta ternary complexes were determined, three at the insertion and two at the extension stage.
26903512 The Proliferating Cell Nuclear Antigen (PCNA)-interacting Protein (PIP) Motif of DNA Polymerase eta Mediates Its Interaction with the C-terminal Domain of Rev1.
26740629 This is the first crystal structure of a DNA polymerase with an incoming rNTP opposite a DNA lesion.
25963146 Pol nu catalyzes both correct and mispair formation with high catalytic efficiency.
23045531 WRN improves the efficiency and fidelity of hpol eta to promote more effective replication of DNA.
22623772 Epstein-Barr virus BPLF1 deubiquitinates PCNA and attenuates polymerase eta recruitment to DNA damage sites
22262850 both yeast and human pol eta synthesize past the 3'-(m)C CPD in a >99% error-free manner, consistent with the highly water-exposed nature of the active site.
22008035 The lower fidelity of POLN compared to that of Klenow fragment of Escherichia coli can be attributed to a much lower catalytic efficiency for correct dNTP incorporation, whereas both enzymes have similar kinetic parameters for G-dTTP misinsertion.
21671477 Our finding suggests that polymorphisms in DNA repair genes, POLN and PRKDC, were associated with increased melanoma risk in melanoma families with and without CDKN2A mutations.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MENYEALVGFDLCNTPLSSVAQKIMSAMHSGDLVDSKTWGKSTETMEVINKSSVKYSVQLEDRKTQSPEK      1 - 70
KDLKSLRSQTSRGSAKLSPQSFSVRLTDQLSADQKQKSISSLTLSSCLIPQYNQEASVLQKKGHKRKHFL     71 - 140
MENINNENKGSINLKRKHITYNNLSEKTSKQMALEEDTDDAEGYLNSGNSGALKKHFCDIRHLDDWAKSQ    141 - 210
LIEMLKQAAALVITVMYTDGSTQLGADQTPVSSVRGIVVLVKRQAEGGHGCPDAPACGPVLEGFVSDDPC    211 - 280
IYIQIEHSAIWDQEQEAHQQFARNVLFQTMKCKCPVICFNAKDFVRIVLQFFGNDGSWKHVADFIGLDPR    281 - 350
IAAWLIDPSDATPSFEDLVEKYCEKSITVKVNSTYGNSSRNIVNQNVRENLKTLYRLTMDLCSKLKDYGL    351 - 420
WQLFRTLELPLIPILAVMESHAIQVNKEEMEKTSALLGARLKELEQEAHFVAGERFLITSNNQLREILFG    421 - 490
KLKLHLLSQRNSLPRTGLQKYPSTSEAVLNALRDLHPLPKIILEYRQVHKIKSTFVDGLLACMKKGSISS    491 - 560
TWNQTGTVTGRLSAKHPNIQGISKHPIQITTPKNFKGKEDKILTISPRAMFVSSKGHTFLAADFSQIELR    561 - 630
ILTHLSGDPELLKLFQESERDDVFSTLTSQWKDVPVEQVTHADREQTKKVVYAVVYGAGKERLAACLGVP    631 - 700
IQEAAQFLESFLQKYKKIKDFARAAIAQCHQTGCVVSIMGRRRPLPRIHAHDQQLRAQAERQAVNFVVQG    701 - 770
SAADLCKLAMIHVFTAVAASHTLTARLVAQIHDELLFEVEDPQIPECAALVRRTMESLEQVQALELQLQV    771 - 840
PLKVSLSAGRSWGHLVPLQEAWGPPPGPCRTESPSNSLAAPGSPASTQPPPLHFSPSFCL              841 - 900
//

Text Mined References (18)

PMID Year Title
27226627 2016 Structural and Kinetic Analysis of Miscoding Opposite the DNA Adduct 1,N6-Ethenodeoxyadenosine by Human Translesion DNA Polymerase ?.
26903512 2016 The Proliferating Cell Nuclear Antigen (PCNA)-interacting Protein (PIP) Motif of DNA Polymerase ? Mediates Its Interaction with the C-terminal Domain of Rev1.
26740629 2016 Mechanism of Ribonucleotide Incorporation by Human DNA Polymerase ?.
25963146 2015 Human DNA Polymerase ? Catalyzes Correct and Incorrect DNA Synthesis with High Catalytic Efficiency.
23045531 2012 Enhancement of human DNA polymerase ? activity and fidelity is dependent upon a bipartite interaction with the Werner syndrome protein.
22623772 2012 Epstein-Barr virus BPLF1 deubiquitinates PCNA and attenuates polymerase ? recruitment to DNA damage sites.
22262850 2012 Preparation of site-specific T=mCG cis-syn cyclobutane dimer-containing template and its error-free bypass by yeast and human polymerase ?.
22159054 2011 A comprehensive genetic association study of Alzheimer disease in African Americans.
22008035 2011 Kinetic analysis of the unique error signature of human DNA polymerase ?.
21671477 2012 Genetic variants in DNA repair genes and the risk of cutaneous malignant melanoma in melanoma-prone families with/without CDKN2A mutations.
More...