Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.23
PubTator Score 37.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
lung adenocarcinoma -1.400 0.000
lung carcinoma -1.500 0.000
psoriasis -2.900 0.000

Gene RIF (2)

PMID Text
25028495 17beta-HSD13 as a pathogenic protein in the development of nonalcoholic fatty liver disease.
17311113 A new human short-chain dehydrogenase/reductase gene SCDR9 is cloned and expressed.

AA Sequence

MNIILEILLLLITIIYSYLESLVKFFIPQRRKSVAGEIVLITGAGHGIGRQTTYEFAKRQSILVLWDINK      1 - 70
RGVEETAAECRKLGVTAHAYVVDCSNREEIYRSLNQVKKEVGDVTIVVNNAGTVYPADLLSTKDEEITKT     71 - 140
FEVNILGHFWITKALLPSMMERNHGHIVTVASVCGHEGIPYLIPYCSSKFAAVGFHRGLTSELQALGKTG    141 - 210
IKTSCLCPVFVNTGFTKNPSTRLWPVLETDEVVRSLIDGILTNKKMIFVPSYINIFLRLQKFLPERASAI    211 - 280
LNRMQNIQFEAVVGHKIKMK                                                      281 - 300
//

Text Mined References (12)

PMID Year Title
25028495 2014 Comparative proteomic study reveals 17?-HSD13 as a pathogenic protein in nonalcoholic fatty liver disease.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23568457 2013 Genetic variants associated with disordered eating.
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
22001757 2011 Genome-wide association study identifies loci influencing concentrations of liver enzymes in plasma.
19027726 2009 The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
17311113 2007 Molecular cloning and expression analysis of a new gene for short-chain dehydrogenase/reductase 9.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15221005 2004 Expression profiling and differential screening between hepatoblastomas and the corresponding normal livers: identification of high expression of the PLK1 oncogene as a poor-prognostic indicator of hepatoblastomas.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...