Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.73
PubTator Score 37.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 7.1e-70
lung adenocarcinoma 2716 8.8e-12
lung carcinoma 2843 1.7e-06
Disease Target Count Z-score Confidence
Fatty liver disease 103 3.125 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
lung adenocarcinoma -1.400 8.8e-12
lung carcinoma -1.500 1.7e-06
psoriasis -2.900 7.1e-70

Synonym

Accession Q7Z5P4 A8K9R9 Q2M1L5 Q86W22 Q86W23 17-beta-HSD 13
Symbols SCDR9
NIIL497
SDR16C3
HMFN0376

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MNIILEILLLLITIIYSYLESLVKFFIPQRRKSVAGEIVLITGAGHGIGRQTTYEFAKRQSILVLWDINK      1 - 70
RGVEETAAECRKLGVTAHAYVVDCSNREEIYRSLNQVKKEVGDVTIVVNNAGTVYPADLLSTKDEEITKT     71 - 140
FEVNILGHFWITKALLPSMMERNHGHIVTVASVCGHEGIPYLIPYCSSKFAAVGFHRGLTSELQALGKTG    141 - 210
IKTSCLCPVFVNTGFTKNPSTRLWPVLETDEVVRSLIDGILTNKKMIFVPSYINIFLRLQKFLPERASAI    211 - 280
LNRMQNIQFEAVVGHKIKMK                                                      281 - 300
//

Text Mined References (12)

PMID Year Title