Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.70
PubTator Score 0.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
Atopic dermatitis -2.900 3.8e-05
atypical teratoid / rhabdoid tumor -1.200 3.3e-06
ependymoma -1.400 4.7e-10
group 3 medulloblastoma -1.400 2.8e-02
ovarian cancer -2.200 1.2e-15
primitive neuroectodermal tumor -1.200 4.2e-02
psoriasis -1.400 1.3e-16

AA Sequence

MDAQDCQAAASPEPPGPPARSCVAAWWDMVDRNLRYFPHSCSMLGRKIAALYDSFTSKSLKEHVFLPLID      1 - 70
MLIYFNFFKAPFLVDLKKPELKIPHTVNFYLRVEPGVMLGIWHTVPSCRGEDAKGKDCCWYEAALRDGNP     71 - 140
IIVYLHGSAEHRAASHRLKLVKVLSDGGFHVLSVDYRGFGDSTGKPTEEGLTTDAICVYEWTKARSGITP    141 - 210
VCLWGHSLGTGVATNAAKVLEEKGCPVDAIVLEAPFTNMWVASINYPLLKIYRNIPGFLRTLMDALRKDK    211 - 280
IIFPNDENVKFLSSPLLILHGEDDRTVPLEYGKKLYEIARNAYRNKERVKMVIFPPGFQHNLLCKSPTLL    281 - 350
ITVRDFLSKQWS                                                              351 - 362
//

Text Mined References (6)

PMID Year Title