Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.68
PubTator Score 0.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
ependymoma -1.400 0.000
group 3 medulloblastoma -1.400 0.028
atypical teratoid/rhabdoid tumor -1.300 0.000
primitive neuroectodermal tumor -1.200 0.042
Atopic dermatitis -2.900 0.000
psoriasis -1.600 0.000
ovarian cancer -2.200 0.000

Synonym

Accession Q7Z5M8 Q3KNR9 Q3KNS0 Q7Z5M6 Q7Z5M7 Q8N4D2
Symbols BEM46L3
C14orf29
c14_5314

Gene

 GO Function (1)

 Compartment GO Term (1)

AA Sequence

MDAQDCQAAASPEPPGPPARSCVAAWWDMVDRNLRYFPHSCSMLGRKIAALYDSFTSKSLKEHVFLPLID      1 - 70
MLIYFNFFKAPFLVDLKKPELKIPHTVNFYLRVEPGVMLGIWHTVPSCRGEDAKGKDCCWYEAALRDGNP     71 - 140
IIVYLHGSAEHRAASHRLKLVKVLSDGGFHVLSVDYRGFGDSTGKPTEEGLTTDAICVYEWTKARSGITP    141 - 210
VCLWGHSLGTGVATNAAKVLEEKGCPVDAIVLEAPFTNMWVASINYPLLKIYRNIPGFLRTLMDALRKDK    211 - 280
IIFPNDENVKFLSSPLLILHGEDDRTVPLEYGKKLYEIARNAYRNKERVKMVIFPPGFQHNLLCKSPTLL    281 - 350
ITVRDFLSKQWS                                                              351 - 362
//

Text Mined References (6)

PMID Year Title
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.