Property Summary

NCBI Gene PubMed Count 17
PubMed Score 9.15
PubTator Score 8.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 4.74894956917427E-16
juvenile dermatomyositis 1189 1.70757128818889E-7
atypical teratoid / rhabdoid tumor 4369 3.53192260547761E-7
Pick disease 1893 9.21988340797312E-7
medulloblastoma, large-cell 6234 1.23603421874996E-6
glioblastoma 5572 7.06576473600099E-5
osteosarcoma 7933 1.78741525140225E-4
group 3 medulloblastoma 2254 4.77746086818504E-4
ovarian cancer 8492 0.00122156325647234
adult high grade glioma 2148 0.00237343657406389
oligodendroglioma 2849 0.00380555021350386
primitive neuroectodermal tumor 3031 0.0057711376398107
pancreatic cancer 2300 0.00791738556182561
primary pancreatic ductal adenocarcinoma 1271 0.00868158604132847
ependymoma 2514 0.00929131634654322
breast carcinoma 1614 0.0126942256789038
astrocytic glioma 2241 0.0181252147324558
Alzheimer's disease 644 0.0328943073012963

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytic glioma 1.100 0.018
ependymoma 1.400 0.009
oligodendroglioma 1.400 0.004
osteosarcoma -1.275 0.000
glioblastoma 1.500 0.000
group 3 medulloblastoma 1.900 0.000
atypical teratoid / rhabdoid tumor 1.600 0.000
medulloblastoma, large-cell 2.300 0.000
primitive neuroectodermal tumor 1.300 0.006
juvenile dermatomyositis 1.214 0.000
primary pancreatic ductal adenocarcinoma 1.783 0.009
breast carcinoma 1.300 0.013
adult high grade glioma 1.500 0.002
psoriasis -1.300 0.000
Alzheimer's disease 1.200 0.033
Pick disease 2.100 0.000
ovarian cancer 1.500 0.001
pancreatic cancer 1.800 0.008

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Pathway (1)

Gene RIF (9)

PMID Text
26593974 ETO2 and IRF2BP2 interacting with the NCOR1/SMRT co-repressor complex, suppresses the expression of erythroid genes until erythroid differentiation.
26195219 A deletion variant that lowers IRF2BP2 expression predisposes to coronary artery disease in humans.
23185413 analysis of an IRF2BP2-CDX1 fusion gene brought about by translocation t(1;5)(q42;q32) in mesenchymal chondrosarcoma
21887377 Nuclear localization of IRF2BP2 depends on phosphorylation near a conserved NLS. Changes in phosphorylation status likely control nucleocytoplasmic localization of IRF2BP2 during muscle differentiation.
21576369 Data demonstrate that IRF-2BP2 is a negative regulator of the NFAT1 transcription factor and suggest that NFAT1 repression occurs at the transcriptional level.
20702774 IRF2BP2 is a novel ischemia-induced coactivator of VEGFA expression that may contribute to revascularization of ischemic cardiac and skeletal muscles.
20702774 IRF2BP2 works with TEAD transcription factors to upregulate the expression of VEGFA in skeletal and cardiac muscle. IRF2BP2 protein levels are increased in response to tissue ischemia.
19190336 results indicate that DIF-1 plays a key role in breast cancer cell survival
12799427 Identification of IRF-2 binding protein 1 and IRF-2 binding protein 2 as co-repressor molecules for interferon regulatory factor-2.

AA Sequence

MAAAVAVAAASRRQSCYLCDLPRMPWAMIWDFTEPVCRGCVNYEGADRVEFVIETARQLKRAHGCFPEGR      1 - 70
SPPGAAASAAAKPPPLSAKDILLQQQQQLGHGGPEAAPRAPQALERYPLAAAAERPPRLGSDFGSSRPAA     71 - 140
SLAQPPTPQPPPVNGILVPNGFSKLEEPPELNRQSPNPRRGHAVPPTLVPLMNGSATPLPTALGLGGRAA    141 - 210
ASLAAVSGTAAASLGSAQPTDLGAHKRPASVSSSAAVEHEQREAAAKEKQPPPPAHRGPADSLSTAAGAA    211 - 280
ELSAEGAGKSRGSGEQDWVNRPKTVRDTLLALHQHGHSGPFESKFKKEPALTAGRLLGFEANGANGSKAV    281 - 350
ARTARKRKPSPEPEGEVGPPKINGEAQPWLSTSTEGLKIPMTPTSSFVSPPPPTASPHSNRTTPPEAAQN    351 - 420
GQSPMAALILVADNAGGSHASKDANQVHSTTRRNSNSPPSPSSMNQRRLGPREVGGQGAGNTGGLEPVHP    421 - 490
ASLPDSSLATSAPLCCTLCHERLEDTHFVQCPSVPSHKFCFPCSRQSIKQQGASGEVYCPSGEKCPLVGS    491 - 560
NVPWAFMQGEIATILAGDVKVKKERDS                                               561 - 587
//

Text Mined References (32)

PMID Year Title
26593974 2015 Control of developmentally primed erythroid genes by combinatorial co-repressor actions.
26195219 2015 IRF2BP2 Reduces Macrophage Inflammation and Susceptibility to Atherosclerosis.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23185413 2012 Whole-transcriptome sequencing identifies novel IRF2BP2-CDX1 fusion gene brought about by translocation t(1;5)(q42;q32) in mesenchymal chondrosarcoma.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22688191 2012 Genome-wide association study in a Swedish population yields support for greater CNV and MHC involvement in schizophrenia compared with bipolar disorder.
22247754 2012 Genome-wide association of implantable cardioverter-defibrillator activation with life-threatening arrhythmias.
More...