Property Summary

NCBI Gene PubMed Count 18
PubMed Score 12.75
PubTator Score 8.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma 1.500 2.4e-03
Alzheimer's disease 1.200 3.3e-02
astrocytic glioma 1.100 1.8e-02
atypical teratoid / rhabdoid tumor 1.500 9.3e-05
breast carcinoma 1.300 1.3e-02
ependymoma 1.400 9.3e-03
glioblastoma 1.200 1.0e-05
group 3 medulloblastoma 1.900 4.8e-04
juvenile dermatomyositis 1.214 1.7e-07
medulloblastoma, large-cell 2.100 4.7e-06
oligodendroglioma 1.400 3.8e-03
osteosarcoma -1.275 1.8e-04
ovarian cancer 1.500 1.2e-03
pancreatic cancer 1.800 7.9e-03
Pick disease 2.100 9.2e-07
primary pancreatic ductal adenocarcinoma 1.783 8.7e-03
primitive neuroectodermal tumor 1.300 5.8e-03
psoriasis -1.300 4.7e-16

Gene RIF (10)

AA Sequence

MAAAVAVAAASRRQSCYLCDLPRMPWAMIWDFTEPVCRGCVNYEGADRVEFVIETARQLKRAHGCFPEGR      1 - 70
SPPGAAASAAAKPPPLSAKDILLQQQQQLGHGGPEAAPRAPQALERYPLAAAAERPPRLGSDFGSSRPAA     71 - 140
SLAQPPTPQPPPVNGILVPNGFSKLEEPPELNRQSPNPRRGHAVPPTLVPLMNGSATPLPTALGLGGRAA    141 - 210
ASLAAVSGTAAASLGSAQPTDLGAHKRPASVSSSAAVEHEQREAAAKEKQPPPPAHRGPADSLSTAAGAA    211 - 280
ELSAEGAGKSRGSGEQDWVNRPKTVRDTLLALHQHGHSGPFESKFKKEPALTAGRLLGFEANGANGSKAV    281 - 350
ARTARKRKPSPEPEGEVGPPKINGEAQPWLSTSTEGLKIPMTPTSSFVSPPPPTASPHSNRTTPPEAAQN    351 - 420
GQSPMAALILVADNAGGSHASKDANQVHSTTRRNSNSPPSPSSMNQRRLGPREVGGQGAGNTGGLEPVHP    421 - 490
ASLPDSSLATSAPLCCTLCHERLEDTHFVQCPSVPSHKFCFPCSRQSIKQQGASGEVYCPSGEKCPLVGS    491 - 560
NVPWAFMQGEIATILAGDVKVKKERDS                                               561 - 587
//

Text Mined References (34)

PMID Year Title