Property Summary

NCBI Gene PubMed Count 11
PubMed Score 48.00
PubTator Score 11.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
cystic fibrosis -1.037 1.6e-03
ductal carcinoma in situ -1.500 1.6e-02
intraductal papillary-mucinous carcinoma... -1.200 1.6e-04
intraductal papillary-mucinous neoplasm ... -1.300 1.6e-03
invasive ductal carcinoma -1.800 1.9e-02
lung carcinoma -1.600 1.8e-15
ovarian cancer -2.100 9.1e-20
pancreatic cancer 1.300 1.8e-03
primary pancreatic ductal adenocarcinoma 1.150 3.7e-03
psoriasis -1.100 4.8e-22

Gene RIF (4)

AA Sequence

MAQSRVLLLLLLLPPQLHLGPVLAVRAPGFGRSGGHSLSPEENEFAEEEPVLVLSPEEPGPGPAAVSCPR      1 - 70
DCACSQEGVVDCGGIDLREFPGDLPEHTNHLSLQNNQLEKIYPEELSRLHRLETLNLQNNRLTSRGLPEK     71 - 140
AFEHLTNLNYLYLANNKLTLAPRFLPNALISVDFAANYLTKIYGLTFGQKPNLRSVYLHNNKLADAGLPD    141 - 210
NMFNGSSNVEVLILSSNFLRHVPKHLPPALYKLHLKNNKLEKIPPGAFSELSSLRELYLQNNYLTDEGLD    211 - 280
NETFWKLSSLEYLDLSSNNLSRVPAGLPRSLVLLHLEKNAIRSVDANVLTPIRSLEYLLLHSNQLREQGI    281 - 350
HPLAFQGLKRLHTVHLYNNALERVPSGLPRRVRTLMILHNQITGIGREDFATTYFLEELNLSYNRITSPQ    351 - 420
VHRDAFRKLRLLRSLDLSGNRLHTLPPGLPRNVHVLKVKRNELAALARGALVGMAQLRELYLTSNRLRSR    421 - 490
ALGPRAWVDLAHLQLLDIAGNQLTEIPEGLPESLEYLYLQNNKISAVPANAFDSTPNLKGIFLRFNKLAV    491 - 560
GSVVDSAFRRLKHLQVLDIEGNLEFGDISKDRGRLGKEKEEEEEEEEEEEETR                     561 - 613
//

Text Mined References (14)

PMID Year Title