Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.03
PubTator Score 2.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Renal Cell Carcinoma 199
Disease Target Count P-value
non-small cell lung cancer 2798 6.84267025063651E-9
facioscapulohumeral dystrophy 286 2.74497594952746E-7
tuberculosis 1563 1.15191814180153E-5
nasopharyngeal carcinoma 1056 1.71234684759836E-5
interstitial cystitis 2299 6.50955839267897E-5
ovarian cancer 8492 0.00192524956339447
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00637584580376946

Expression

  Differential Expression (7)

Synonym

Accession Q7Z5L0 C9JQ15 E9PAU9 E9PGP4 Q3SXP1 Q8IUY1
Symbols ERGA6350
PRO21055

Gene

  Ortholog (13)

AA Sequence

MERGAGAKLLPLLLLLRATGFTCAQTDGRNGYTAVIEVTSGGPWGDWAWPEMCPDGFFASGFSLKVEPPQ      1 - 70
GIPGDDTALNGIRLHCARGNVLGNTHVVESQSGSWGEWSEPLWCRGGAYLVAFSLRVEAPTTLGDNTAAN     71 - 140
NVRFRCSDGEELQGPGLSWGDFGDWSDHCPKGACGLQTKIQGPRGLGDDTALNDARLFCCRS            141 - 202
//

Text Mined References (9)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22025569 2011 Analysis and comparison of proteomic profiles of tear fluid from human, cow, sheep, and camel eyes.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.