Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.03
PubTator Score 2.70

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
facioscapulohumeral dystrophy 3.100 2.7e-07
interstitial cystitis 1.300 6.5e-05
nasopharyngeal carcinoma -1.300 1.7e-05
non-small cell lung cancer -1.034 6.8e-09
ovarian cancer 1.100 1.9e-03
pancreatic ductal adenocarcinoma liver m... -1.010 6.4e-03
tuberculosis -1.800 1.2e-05

 GO Component (1)

 Compartment GO Term (1)

AA Sequence

MERGAGAKLLPLLLLLRATGFTCAQTDGRNGYTAVIEVTSGGPWGDWAWPEMCPDGFFASGFSLKVEPPQ      1 - 70
GIPGDDTALNGIRLHCARGNVLGNTHVVESQSGSWGEWSEPLWCRGGAYLVAFSLRVEAPTTLGDNTAAN     71 - 140
NVRFRCSDGEELQGPGLSWGDFGDWSDHCPKGACGLQTKIQGPRGLGDDTALNDARLFCCRS            141 - 202
//

Text Mined References (9)

PMID Year Title