Property Summary

NCBI Gene PubMed Count 29
Grant Count 19
R01 Count 9
Funding $3,628,639.05
PubMed Score 166.83
PubTator Score 73.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.106 0.017
malignant mesothelioma 1.200 0.000
psoriasis 1.700 0.000
medulloblastoma, large-cell 1.200 0.000
acute quadriplegic myopathy 1.262 0.000
Breast cancer 2.600 0.028
ovarian cancer 2.100 0.000

Gene RIF (10)

PMID Text
24055153 WAPL-depleted cells undergo anaphase with segregation errors, resulting in micronuclei and DNA damage. Stable WAPL depletion arrests cells in a p53-dependent manner but causes p53-deficient cells to become highly aneuploid.
23776203 Wapl-C interacts with other cohesin subunits and possibly unknown effectors to trigger cohesin release from chromatin
22751501 Depletion of Wapl, a negative cohesin regulator, rescues sister chromatid homologous recombination defects of Mms21-deficient or Scc1 mutant-expressing cells
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18662753 isolated a large number of additional alternatively spliced WAPL variants from various cervical epithelia. Each variant consists of a variable 5'-terminal region and the conserved remainder.
17382297 our study suggests that unscheduled overexpression of WAPL disturbs mitosis and cytokinesis, and contributes to tumor progression by induction of chromosomal instability.
17113138 Wapl is required to unlock cohesin from a particular state in which it is stably bound to chromatin.
17112726 Wapl is a new regulator of sister chromatid resolution and promotes release of cohesin from chromosomes by directly interacting with its regulatory subunits
16385451 Observational study of gene-disease association. (HuGE Navigator)
15383329 FOE encodes a protein of 1227 amino acids with a functional bipartite nuclear localization signal, an arginine-rich motif, a putative nuclear export signal as well as with three highly acidic regions and a predicted coiled-coil domain.

AA Sequence

MTSRFGKTYSRKGGNGSSKFDEVFSNKRTTLSTKWGETTFMAKLGQKRPNFKPDIQEIPKKPKVEEESTG      1 - 70
DPFGFDSDDESLPVSSKNLAQVKCSSYSESSEAAQLEEVTSVLEANSKISHVVVEDTVVSDKCFPLEDTL     71 - 140
LGKEKSTNRIVEDDASISSCNKLITSDKVENFHEEHEKNSHHIHKNADDSTKKPNAETTVASEIKETNDT    141 - 210
WNSQFGKRPESPSEISPIKGSVRTGLFEWDNDFEDIRSEDCILSLDSDPLLEMKDDDFKNRLENLNEAIE    211 - 280
EDIVQSVLRPTNCRTYCRANKTKSSQGASNFDKLMDGTSQALAKANSESSKDGLNQAKKGGVSCGTSFRG    281 - 350
TVGRTRDYTVLHPSCLSVCNVTIQDTMERSMDEFTASTPADLGEAGRLRKKADIATSKTTTRFRPSNTKS    351 - 420
KKDVKLEFFGFEDHETGGDEGGSGSSNYKIKYFGFDDLSESEDDEDDDCQVERKTSKKRTKTAPSPSLQP    421 - 490
PPESNDNSQDSQSGTNNAENLDFTEDLPGVPESVKKPINKQGDKSKENTRKIFSGPKRSPTKAVYNARHW    491 - 560
NHPDSEELPGPPVVKPQSVTVRLSSKEPNQKDDGVFKAPAPPSKVIKTVTIPTQPYQDIVTALKCRREDK    561 - 630
ELYTVVQHVKHFNDVVEFGENQEFTDDIEYLLSGLKSTQPLNTRCLSVISLATKCAMPSFRMHLRAHGMV    631 - 700
AMVFKTLDDSQHHQNLSLCTAALMYILSRDRLNMDLDRASLDLMIRLLELEQDASSAKLLNEKDMNKIKE    701 - 770
KIRRLCETVHNKHLDLENITTGHLAMETLLSLTSKRAGDWFKEELRLLGGLDHIVDKVKECVDHLSRDED    771 - 840
EEKLVASLWGAERCLRVLESVTVHNPENQSYLIAYKDSQLIVSSAKALQHCEELIQQYNRAEDSICLADS    841 - 910
KPLPHQNVTNHVGKAVEDCMRAIIGVLLNLTNDNEWGSTKTGEQDGLIGTALNCVLQVPKYLPQEQRFDI    911 - 980
RVLGLGLLINLVEYSARNRHCLVNMETSCSFDSSICSGEGDDSLRIGGQVHAVQALVQLFLERERAAQLA    981 - 1050
ESKTDELIKDAPTTQHDKSGEWQETSGEIQWVSTEKTDGTEEKHKKEEEDEELDLNKALQHAGKHMEDCI   1051 - 1120
VASYTALLLGCLCQESPINVTTVREYLPEGDFSIMTEMLKKFLSFMNLTCAVGTTGQKSISRVIEYLEHC   1121 - 1190
//

Text Mined References (42)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24055153 2013 WAPL-mediated removal of cohesin protects against segregation errors and aneuploidy.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23776203 2013 Structure of the human cohesin inhibitor Wapl.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22751501 2012 Scc1 sumoylation by Mms21 promotes sister chromatid recombination through counteracting Wapl.
22699663 2012 Genome-wide association study of periodontal pathogen colonization.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...