Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.36
PubTator Score 0.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

AA Sequence

MLRLPKKGLPRFEQVQDEDTYLENLAIQRNASAFFEKYDRSEIQELLTTALVSWLSAKEDVRSQVDLPCG      1 - 70
IMSQMNNVGFSTAILLTPVDPTALLDYREVHQMIRELAIGIYCLNQIPSISLEANYDQSSSCQLPPAYYD     71 - 140
TRIGQILINIDYMLKALWHGIYMPKEKRARFSELWRAIMDIDPDGKPQTNKDIFSEFSSAGLTDITKDPD    141 - 210
FNEIYDEDVNEDPTYDPNSPEETAVFMKYAENIMLKLTFSTTQIQQYENVFIFETGYWLTNAIKYNQDYL    211 - 280
DICTYQRLQQRLYLQKKIIQKHFEKKKDIRRGIGYLKLICFLIPFLLSLKKKMKVPYLSSLLQPFSDDKV    281 - 350
KTERELPPFIYGRDFKCQNFHYKENQYFHVHGGIEFDISTPSIENALEDFQKNLEKIRDCAANTFIEDSG    351 - 420
YKEYYSIPVMEFHGKSYYVIYFELETFYQQLYKTQWWGAINEIVNNLRLKRLPLTDAQLHEQFKKKLGFK    421 - 490
RAMKCKSIPFGMKSAVERGLSAVFHTFSRKTSSSTINVSDEAGYTIFHHAALHNRVSIICQLCNANFKVN    491 - 560
QRRFVTFSQGPTPLHLAAQACSLETTVCLLCSKADYTLSEKRGWMPIHFAAFYDNVCIIIALCRKDPSLL    561 - 630
EAEATAENQCTPLLLAATSGALDTIQYLFSIGANWRKTDIKGNNIIHLSVLTFHTEVLKYIIKLNIPELP    631 - 700
VWKTLVEMLQCESYKRRMMAVMSLEVICLANDQYWRCILDAGTIPALINLLKSSKIKLQCKTVGLLSNIS    701 - 770
THKSAVHALVEAGGIPSLINLLVCDEPEVHSRCAVILYDIAQCENKDVIAKYNGIPSLINLLNLNIENVL    771 - 840
VNVMNCIRVLCIGNENNQRAVREHKGLPYLIRFLSSDSDVLKAVSSAAIAEVGRDNKEIQDAIAMEGAIP    841 - 910
PLVALFKGKQISVQMKGAMAVESLASHNALIQKAFLEKSLTKYLLKLLKAFQIDVKEQGAVALWALAGQT    911 - 980
LKQQKYMAEQIGYSFIINMLLSPSAKMQYVGGEAVIALSKDSRMHQNQICEGNGIAPLVRLLRISTIAEG    981 - 1050
TLLSVIRAVGSICIGVAHTSNPVSQQLVVDENAFPVLIQLLRNHPSPNIKVEVAFSLACIVLGNDVLQKD   1051 - 1120
LHENEGFEYADVLYLLHSTEKDICLRAGYALTLFAFNNRFQQYLILESGIMTISIFERFLESTVETEKAM   1121 - 1190
AAFQIVVLAKVIRDMDHITLSARGVTILVDSLYSVQTSTIVLTGNLIASLAHSRAGIPEAFTTLGTIQRL   1191 - 1260
CYHLYSGIEEVRAACSSALGYLTYNANAFRILLKECRNKPNQFIRIKNNISRDASINPAFLKEFQMQQTL   1261 - 1330
VGLPSLSLEKNGGPSIIPIFKRGKEHRRKLKPKIQPKDSLTLLPPVTNFMGLFKATKKTKDSHNIFSFSS   1331 - 1400
TITSDITNVSRPRIVCLNQLGKHVQKANPEPAEG                                       1401 - 1434
//

Text Mined References (7)

PMID Year Title
25162662 2014 Genome-wide association study identifies variants in PMS1 associated with serum ferritin in a Chinese population.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15110750 2004 Characterization of a novel human gene containing ANK repeats and ARM domains.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.