Property Summary

NCBI Gene PubMed Count 4
PubMed Score 3.96
PubTator Score 17.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ependymoma 4679 8.7e-13
glioblastoma 5792 4.8e-05
adult high grade glioma 3801 4.2e-04
medulloblastoma, large-cell 6241 1.1e-03
group 4 medulloblastoma 1855 1.7e-03
Disease Target Count Z-score Confidence
Choriocarcinoma 14 3.123 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
adult high grade glioma -1.100 4.2e-04
ependymoma -1.200 8.7e-13
glioblastoma -1.200 4.8e-05
group 4 medulloblastoma -1.100 1.7e-03
medulloblastoma, large-cell -1.200 1.1e-03

Gene RIF (1)

AA Sequence

MKVLLLTGLGALFFAYYWDDNFDPASLQGARVLLTGANAGVGEELAYHYARLGSHLVLTAHTEALLQKVV      1 - 70
GNCRKLGAPKVFYIAADMASPEAPESVVQFALDKLGGLDYLVLNHIGGAPAGTRARSPQATRWLMQVNFV     71 - 140
SYVQLTSRALPSLTDSKGSLVVVSSLLGRVPTSFSTPYSAAKFALDGFFGSLRRELDVQDVNVAITMCVL    141 - 210
GLRDRASAAEAVRSSTSRPRQPEHRGVPLQSQTAMFLPPTVPGARTLTETPLRGWPQPKMKSSRQKSKTE    211 - 280
KNDGHLEPVTAWEVQVPRVRRLCRGLARPHLFGHD                                       281 - 315
//

Text Mined References (6)

PMID Year Title