Property Summary

NCBI Gene PubMed Count 4
PubMed Score 3.71
PubTator Score 17.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ependymoma 2514 8.71028276196014E-13
medulloblastoma 1524 3.09431272031956E-5
glioblastoma 5572 4.83628720622219E-5
pediatric high grade glioma 2712 4.84121613105213E-5
medulloblastoma, large-cell 6234 0.00111147166033601
Disease Target Count Z-score Confidence
Choriocarcinoma 10 3.095 1.5

Expression

  Differential Expression (5)

Disease log2 FC p
ependymoma -1.200 0.000
medulloblastoma -1.300 0.000
glioblastoma -1.200 0.000
medulloblastoma, large-cell -1.200 0.001
pediatric high grade glioma -1.100 0.000

Synonym

Accession Q7Z5J1 Q05D45 Q52LF4 Q7Z5I9 Q7Z5J0 Q7Z5P5 Q7Z5P6 Q7Z5P7 Q7Z5P8
Symbols HSD3
11-DH3
SCDR10
SCDR10B
SDR26C2
11-beta-HSD3

Gene

PANTHER Protein Class (2)

  Ortholog (6)

Species Source
Macaque OMA EggNOG
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Anole lizard OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (1)

PMID Text
19436836 cloning, purification, and characterization of SCDR10B; highly expressed in brain (especially in hippocampal neurons); up-regulated in lung cancer cell lines and lung cancer tissue

AA Sequence

MKVLLLTGLGALFFAYYWDDNFDPASLQGARVLLTGANAGVGEELAYHYARLGSHLVLTAHTEALLQKVV      1 - 70
GNCRKLGAPKVFYIAADMASPEAPESVVQFALDKLGGLDYLVLNHIGGAPAGTRARSPQATRWLMQVNFV     71 - 140
SYVQLTSRALPSLTDSKGSLVVVSSLLGRVPTSFSTPYSAAKFALDGFFGSLRRELDVQDVNVAITMCVL    141 - 210
GLRDRASAAEAVRSSTSRPRQPEHRGVPLQSQTAMFLPPTVPGARTLTETPLRGWPQPKMKSSRQKSKTE    211 - 280
KNDGHLEPVTAWEVQVPRVRRLCRGLARPHLFGHD                                       281 - 315
//

Text Mined References (6)

PMID Year Title
20350543 2010 Evolution of 11beta-hydroxysteroid dehydrogenase-type 1 and 11beta-hydroxysteroid dehydrogenase-type 3.
19436836 2009 Isolation and characterization of novel human short-chain dehydrogenase/reductase SCDR10B which is highly expressed in the brain and acts as hydroxysteroid dehydrogenase.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.