Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.29
PubTator Score 2.31

Knowledge Summary

Patent (211)

AA Sequence

MASRYVAVGMILSQTVVGVLGSFSVLLHYLSFYCTGCRLRSTDLIVKHLIVANFLALRCKGVPQTMAAFG      1 - 70
VRYFLNALGCKLVFYLHRVGRGVSIGTTCLLSVFQVITVSSRKSRWAKLKEKAPKHVGFSVLLCWIVCML     71 - 140
VNIIFPMYVTGKWNYTNITVNEDLGYCSGGGNNKIAQTLRAMLLSFPDVLCLGLMLWVSSSMVCILHRHK    141 - 210
QRVQHIDRSDLSPRASPENRATQSILILVSTFVSSYTLSCLFQVCMALLDNPNSLLVNTSALMSVCFPTL    211 - 280
SPFVLMSCDPSVYRFCFAWKR                                                     281 - 301
//

Text Mined References (7)

PMID Year Title