Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.29
PubTator Score 2.31

Knowledge Summary

Patent (211)

AA Sequence

MASRYVAVGMILSQTVVGVLGSFSVLLHYLSFYCTGCRLRSTDLIVKHLIVANFLALRCKGVPQTMAAFG      1 - 70
VRYFLNALGCKLVFYLHRVGRGVSIGTTCLLSVFQVITVSSRKSRWAKLKEKAPKHVGFSVLLCWIVCML     71 - 140
VNIIFPMYVTGKWNYTNITVNEDLGYCSGGGNNKIAQTLRAMLLSFPDVLCLGLMLWVSSSMVCILHRHK    141 - 210
QRVQHIDRSDLSPRASPENRATQSILILVSTFVSSYTLSCLFQVCMALLDNPNSLLVNTSALMSVCFPTL    211 - 280
SPFVLMSCDPSVYRFCFAWKR                                                     281 - 301
//

Text Mined References (7)

PMID Year Title
19952141 2010 Extreme variability among mammalian V1R gene families.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12826614 2003 Evolutionary deterioration of the vomeronasal pheromone transduction pathway in catarrhine primates.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12123587 2002 Novel human vomeronasal receptor-like genes reveal species-specific families.
12044878 2002 Identification of G protein-coupled receptor genes from the human genome sequence.