Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00
PubTator Score 22.67

Knowledge Summary

Patent

No data available

AA Sequence

MLKLVIIENMAEIMLFSLDLLLFSTDILCFNFPSKMIKLPGFITIQIFFYPQASFGISANTILLLFHIFT      1 - 70
FVFSHRSKSIDMIISHLSLIHILLLFTQAILVSLDFFGSQNTQDDLRYKVIVFLNKVMRGLSICTPCLLS     71 - 140
VLQAIISPSIFSLAKLKHPSASHILGFFLFSWVLNMFIGVIFCCTLRLPPVKRGQSSVCHTALFLFAHEL    141 - 210
HPQETVFHTNDFEGCHLYRVHGPLKRLHGDYFIQTIRGYLSAFTQPACPRVSPVKRASQAILLLVSFVFT    211 - 280
YWVDFTFSFSGGVTWINDSLLVWLQVIVANSYAAISPLMLIYADNQIFKTLQMLWFKYLSPPKLMLKFNR    281 - 350
QCGSTKK                                                                   351 - 357
//

Text Mined References (6)

PMID Year Title