Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.89
PubTator Score 0.40

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -3.700 1.1e-02
astrocytic glioma -3.000 3.5e-03
Astrocytoma, Pilocytic -3.500 9.1e-04
atypical teratoid / rhabdoid tumor -5.600 1.6e-07
ependymoma -4.600 1.2e-03
glioblastoma -3.700 2.0e-05
group 4 medulloblastoma -4.800 8.8e-04
lung carcinoma 1.200 5.7e-09
medulloblastoma, large-cell -6.300 1.0e-03
oligodendroglioma -3.200 2.4e-03
primitive neuroectodermal tumor -4.100 1.3e-02
tuberculosis 1.400 8.8e-05

Gene RIF (1)

AA Sequence

MAMVSAMSWVLYLWISACAMLLCHGSLQHTFQQHHLHRPEGGTCEVIAAHRCCNKNRIEERSQTVKCSCL      1 - 70
PGKVAGTTRNRPSCVDASIVIGKWWCEMEPCLEGEECKTLPDNSGWMCATGNKIKTTRIHPRT            71 - 133
//

Text Mined References (13)

PMID Year Title