Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.85
PubTator Score 0.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytoma -3.300 0.000
posterior fossa group A ependymoma -5.000 0.000
oligodendroglioma -3.200 0.002
glioblastoma -5.400 0.000
medulloblastoma -5.700 0.000
atypical teratoid / rhabdoid tumor -5.600 0.000
medulloblastoma, large-cell -6.300 0.001
primitive neuroectodermal tumor -4.100 0.013
tuberculosis 1.400 0.000
pediatric high grade glioma -4.200 0.000
pilocytic astrocytoma -3.500 0.001
lung carcinoma 1.200 0.000

Gene RIF (1)

PMID Text
20664687 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MAMVSAMSWVLYLWISACAMLLCHGSLQHTFQQHHLHRPEGGTCEVIAAHRCCNKNRIEERSQTVKCSCL      1 - 70
PGKVAGTTRNRPSCVDASIVIGKWWCEMEPCLEGEECKTLPDNSGWMCATGNKIKTTRIHPRT            71 - 133
//

Text Mined References (13)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
20664687 2010 Single-nucleotide polymorphisms in chromosome 3p14.1- 3p14.2 are associated with susceptibility of type 2 diabetes with cataract.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15028294 2004 TAFA: a novel secreted family with conserved cysteine residues and restricted expression in the brain.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...