Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.03
PubTator Score 0.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Synonym

Accession Q7Z5A8 B7ZLU0 Q2M1P9 Q7Z5A6
Symbols TAFA3
TAFA-3

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MSERVERNWSTGGWLLALCLAWLWTHLTLAALQPPTATVLVQQGTCEVIAAHRCCNRNRIEERSQTVKCS      1 - 70
CFSGQVAGTTRAKPSCVDASIVLQRWWCQMEPCLPGEECKVLPDLSGWSCSSGHKVKTTKVTR            71 - 133
//

Text Mined References (6)

PMID Year Title