Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 8.5e-04

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.100 8.5e-04

AA Sequence

MSSGGGSRGLLAWLLLLQPWPGQNWAGMAAPRLPSPLLSEEGGENPEASPAPGPEAGPPLNLFTSFPGDS      1 - 70
LLCGRTPLRIVGGVDAEEGRWPWQVSVRTKGRHICGGTLVTATWVLTAGHCISSRFHYSVKMGDRSVYNE     71 - 140
NTSVVVSVQRAFVHPKFSTVTTIRNDLALLQLQHPVNFTSNIQPICIPQENFQVEGRTRCWVTGWGKTPE    141 - 210
REKLASEILQDVDQYIMCYEECNKIIQKALSSTKDVIIKGMVCGYKEQGKDSCQGDSGGRLACEYNDTWV    211 - 280
QVGIVSWGIGCGR                                                             281 - 293
//

Text Mined References (4)

PMID Year Title