Property Summary

NCBI Gene PubMed Count 12
Grant Count 10
R01 Count 10
Funding $1,046,387.14
PubMed Score 11.79
PubTator Score 9.14

Knowledge Summary

Patent

No data available

Expression

Gene RIF (7)

PMID Text
25373726 Results support the hypothesis that akna is a cervical cancer susceptibility genetic factor and suggest that akna transcriptional regulation has a role in the disease; identified an association between high akna expression levels and cervical cancer and squamous intraepithelial lesion, but its direction differs in each disease stage.
21297967 significantly decreased expression of CD18 and AKNA suggests a role for both proteins in the pathogenesis of Vogt-Koyanagi-Harada syndrome
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20507260 Data indicate that AKNA appears to be an important genetic factor associated with the risk cervical cancer.
20507260 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
15869410 AKNA expresses multiple transcripts and protein isoforms as a result of alternative promoter usage, splicing, and polyadenylation.

AA Sequence

MASSETEIRWAEPGLGKGPQRRRWAWAEDKRDVDRSSSQSWEEERLFPNATSPELLEDFRLAQQHLPPLE      1 - 70
WDPHPQPDGHQDSESGETSGEEAEAEDVDSPASSHEPLAWLPQQGRQLDMTEEEPDGTLGSLEVEEAGES     71 - 140
SSRLGYEAGLSLEGHGNTSPMALGHGQARGWVASGEQASGDKLSEHSEVNPSVELSPARSWSSGTVSLDH    141 - 210
PSDSLDSTWEGETDGPQPTALAETLPEGPSHHLLSPDGRTGGSVARATPMEFQDSSAPPAQSPQHATDRW    211 - 280
RRETTRFFCPQPKEHIWKQTKTSPKPLPSRFIGSISPLNPQPRPTRQGRPLPRQGATLAGRSSSNAPKYG    281 - 350
RGQLNYPLPDFSKVGPRVRFPKDESYRPPKSRSHNRKPQAPARPLIFKSPAEIVQEVLLSSGEAALAKDT    351 - 420
PPAHPITRVPQEFQTPEQATELVHQLQEDYHRLLTKYAEAENTIDQLRLGAKVNLFSDPPQPNHSIHTGM    421 - 490
VPQGTKVLSFTIPQPRSAEWWPGPAEDPQASAASGWPSARGDLSPSSLTSMPTLGWLPENRDISEDQSSA    491 - 560
EQTQALASQASQFLAKVESFERLIQAGRLMPQDQVKGFQRLKAAHAALEEEYLKACREQHPAQPLAGSKG    561 - 630
TPGRFDPRRELEAEIYRLGSCLEELKEHIDQTQQEPEPPGSDSALDSTPALPCLHQPTHLPAPSGQAPMP    631 - 700
AIKTSCPEPATTTAAASTGPCPLHVNVEVSSGNSEVEDRPQDPLARLRHKELQMEQVYHGLMERYLSVKS    701 - 770
LPEAMRMEEEEEGEEEEEEEGGGDSLEVDGVAATPGKAEATRVLPRQCPVQAEKSHGAPLEEATEKMVSM    771 - 840
KPPGFQASLARDGHMSGLGKAEAAPPGPGVPPHPPGTKSAASHQSSMTSLEGSGISERLPQKPLHRGGGP    841 - 910
HLEETWMASPETDSGFVGSETSRVSPLTQTPEHRLSHISTAGTLAQPFAASVPRDGASYPKARGSLIPRR    911 - 980
ATEPSTPRSQAQRYLSSPSGPLRQRAPNFSLERTLAAEMAVPGSEFEGHKRISEQPLPNKTISPPPAPAP    981 - 1050
AAAPLPCGPTETIPSFLLTRAGRDQAICELQEEVSRLRLRLEDSLHQPLQGSPTRPASAFDRPARTRGRP   1051 - 1120
ADSPATWGSHYGSKSTERLPGEPRGEEQIVPPGRQRARSSSVPREVLRLSLSSESELPSLPLFSEKSKTT   1121 - 1190
KDSPQAARDGKRGVGSAGWPDRVTFRGQYTGHEYHVLSPKAVPKGNGTVSCPHCRPIRTQDAGGAVTGDP   1191 - 1260
LGPPPADTLQCPLCGQVGSPPEADGPGSATSGAEKATTRRKASSTPSPKQRSKQAGSSPRPPPGLWYLAT   1261 - 1330
APPAPAPPAFAYISSVPIMPYPPAAVYYAPAGPTSAQPAAKWPPTASPPPARRHRHSIQLDLGDLEELNK   1331 - 1400
ALSRAVQAAESVRSTTRQMRSSLSADLRQAHSLRGSCLF                                  1401 - 1439
//

Text Mined References (16)

PMID Year Title
25373726 Cervical cancer-associated promoter polymorphism affects akna expression levels.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21297967 2011 Label-free proteomics reveals decreased expression of CD18 and AKNA in peripheral CD4+ T cells from patients with Vogt-Koyanagi-Harada syndrome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20507260 2010 A polymorphism in the AT-hook motif of the transcriptional regulator AKNA is a risk factor for cervical cancer.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
16000308 2005 Novel interaction partners of the CD2BP2-GYF domain.
15869410 2005 The human AKNA gene expresses multiple transcripts and protein isoforms as a result of alternative promoter usage, splicing, and polyadenylation.
More...