Property Summary

NCBI Gene PubMed Count 46
PubMed Score 29.23
PubTator Score 32.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Synonym

Accession Q7Z589 B7ZKT8 B7ZKU0 B7ZKU2 Q17RM7 Q4G109 Q8NBU6 Q8TE50 Q9H8I9 Q9NRH0
Symbols GL002
C11orf30

Gene

PDB

1UTU   1UZ3   2FMM  

Gene RIF (32)

PMID Text
26841866 identify a novel substoichiometric interactor of the complex, transcription factor ZNF131, which recruits EMSY to a large number of active, H3K4me3 marked promoters.
26464032 The rs2155219 single nucleotide polymorphism was significantly associated with atopic dermatitis.
25546184 The association of higher levels of expression of C11orf30 may be involved in transcription repression of interferon-stimulated genes, and its association with sensitization to multiple allergens suggest that this locus is highly relevant for atopy.
25510665 Our study demonstrated that EMSY played an oncogenic role in the progression of ovarian cancer cells and EMSY might be a promising target for the treatment
25407941 Eosinophilic esophagitis was associate with increased expression of C11orf30.
24641409 Univariate analysis revealed a significant positive association between EMSY expression and lymph node metastasis, larger tumor size, as well as a non-significant relation with increased risk of recurrence.
24582497 EMSY is recruited to the miR-31 promoter by the DNA binding factor ETS-1, and it represses miR-31 transcription by delivering the H3K4me3 demethylase JARID1b/PLU-1/KDM5B
22315412 Akt1 regulates the interferon response through phosphorylation of the transcriptional repressor EMSY
22070912 There are 2 independent signals, one in C11orf30 and the other in LRRC32, that are strongly associated with serum IgE levels. C11orf30-LRRC32 region may represent a common locus for atopic diseases via pathways involved in regulation of serum IgE levels
21409565 EMSY amplification may mimic BRCA2 deficiency, at least by overriding RPA and PALB2, crippling the BRCA2/RAD51 complex at DNA-damage and replication/transcription sites
More...

AA Sequence

MPVVWPTLLDLSRDECKRILRKLELEAYAGVISALRAQGDLTKEKKDLLGELSKVLSISTERHRAEVRRA      1 - 70
VNDERLTTIAHNMSGPNSSSEWSIEGRRLVPLMPRLVPQTAFTVTANAVANAAIQHNASLPVPAETGSKE     71 - 140
VVCYSYTSTTSTPTSTPVPSGSIATVKSPRPASPASNVVVLPSGSTVYVKSVSCSDEDEKPRKRRRTNSS    141 - 210
SSSPVVLKEVPKAVVPVSKTITVPVSGSPKMSNIMQSIANSLPPHMSPVKITFTKPSTQTTNTTTQKVII    211 - 280
VTTSPSSTFVPNILSKSHNYAAVTKLVPTSVIASTTQKPPVVITASQSSLVSNSSSGSSSSTPSPIPNTV    281 - 350
AVTAVVSSTPSVVMSTVAQGVSTSAIKMASTRLPSPKSLVSAPTQILAQFPKQHQQSPKQQLYQVQQQTQ    351 - 420
QQVAQPSPVSHQQQPQQSPLPPGIKPTIQIKQESGVKIITQQVQPSKILPKPVTATLPTSSNSPIMVVSS    421 - 490
NGAIMTTKLVTTPTGTQATYTRPTVSPSIGRMAATPGAATYVKTTSGSIITVVPKSLATLGGKIISSNIV    491 - 560
SGTTTKITTIPMTSKPNVIVVQKTTGKGTTIQGLPGKNVVTTLLNAGGEKTIQTVPTGAKPAILTATRPI    561 - 630
TKMIVTQPKGIGSTVQPAAKIIPTKIVYGQQGKTQVLIKPKPVTFQATVVSEQTRQLVTETLQQASRVAE    631 - 700
AGNSSIQEGKEEPQNYTDSSSSSTESSQSSQDSQPVVHVIASRRQDWSEHEIAMETSPTIIYQDVSSESQ    701 - 770
SATSTIKALLELQQTTVKEKLESKPRQPTIDLSQMAVPIQMTQEKRHSPESPSIAVVESELVAEYITTER    771 - 840
TDEGTEVAFPLLVSHRSQPQQPSQPQRTLLQHVAQSQTATQTSVVVKSIPASSPGAITHIMQQALSSHTA    841 - 910
FTKHSEELGTEEGEVEEMDTLDPQTGLFYRSALTQSQSAKQQKLSQPPLEQTQLQVKTLQCFQTKQKQTI    911 - 980
HLQADQLQHKLPQMPQLSIRHQKLTPLQQEQAQPKPDVQHTQHPMVAKDRQLPTLMAQPPQTVVQVLAVK    981 - 1050
TTQQLPKLQQAPNQPKIYVQPQTPQSQMSLPASSEKQTASQVEQPIITQGSSVTKITFEGRQPPTVTKIT   1051 - 1120
GGSSVPKLTSPVTSISPIQASEKTAVSDILKMSLMEAQIDTNVEHMIVDPPKKALATSMLTGEAGSLPST   1121 - 1190
HMVVAGMANSTPQQQKCRESCSSPSTVGSSLTTRKIDPPAVPATGQFMRIQNVGQKKAEESPAEIIIQAI   1191 - 1260
PQYAIPCHSSSNVVVEPSGLLELNNFTSQQLDDEETAMEQDIDSSTEDGTEPSPSQSSAERS           1261 - 1322
//

Text Mined References (56)

PMID Year Title
26841866 2016 Recruitment of the Mammalian Histone-modifying EMSY Complex to Target Genes Is Regulated by ZNF131.
26464032 2015 Association analysis of allergic sensitization susceptibility loci with atopic dermatitis in Chinese population.
25546184 2015 The locus C11orf30 increases susceptibility to poly-sensitization.
25510665 2015 EMSY promoted the growth and migration of ovarian cancer cells.
25416956 2014 A proteome-scale map of the human interactome network.
25407941 2014 GWAS identifies four novel eosinophilic esophagitis loci.
25017104 2014 Genome-wide association analysis of eosinophilic esophagitis provides insight into the tissue specificity of this allergic disease.
24641409 2014 Expression of EMSY, a novel BRCA2-link protein, is associated with lymph node metastasis and increased tumor size in breast carcinomas.
24582497 2014 The breast cancer oncogene EMSY represses transcription of antimetastatic microRNA miR-31.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...