Property Summary

NCBI Gene PubMed Count 91
Grant Count 5
Funding $1,778,447.5
PubMed Score 96.28
PubTator Score 148.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Waldenstrons macroglobulinemia 2.604 0.005
malignant mesothelioma -2.100 0.000
ependymoma -2.600 0.000
glioblastoma -1.500 0.016
cystic fibrosis -1.233 0.000
adult high grade glioma -1.900 0.000
group 4 medulloblastoma 2.300 0.006
pilocytic astrocytoma -1.400 0.000
mucosa-associated lymphoid tissue lympho... -1.055 0.011
pituitary cancer 4.900 0.000

Gene RIF (89)

PMID Text
26934312 results did not support the association of rs1344706 with schizophrenia in Han Chinese
26670283 The single-nucleotide polymorphism rs1344706 (A/C) at the second intron of gene ZNF804A on 2q32.1 is the most widely supported of all the genome-wide association studies-identified risk factors in schizophrenia.
26654932 ZNF804A SNP rs1344706 was associated with the functional connectivity between right dorsolateral prefrontal cortex and left hippocampal formation
26382569 SNPs have also been implicated for regulating ZNF804A expression in human brain. In this independent replication study, we tested the rs7597593 and rs1344706 SNP genotypes and their corresponding haplotypes for association with heroin addiction
26164821 This study demontrated that ZNF804A expression in developmental brain.
25921517 ZNF804A rs1344706 may aggravate the risk for schizophrenia by exerting its effects on cortical thickness, surface area, and cortical volume in these brain regions.
25905630 findings suggest that ZNF804A may affect a differentiating neuron's response to inflammatory cytokines
25896933 P3b latencies were more variable for AA carriers than C carriers. Intra-subject variability, was not associated with genotype. Results suggest that this risk gene is associated with an attenuated form of an endophenotype associated with the psychosis.
25757652 Study found a significant decrease in intrahippocampal theta (using MEG) and greater coactivation of the superior frontal gyrus with the hippocampal network (using fMRI) in risk versus nonrisk ZNF804A rs1344706 homozygotes
25526981 Single nucleotide polymorphism rs1344706 of ZNF804A is associated with schizophrenia.
More...

AA Sequence

MECYYIVISSTHLSNGHFRNIKGVFRGPLSKNGNKTLDYAEKENTIAKALEDLKANFYCELCDKQYYKHQ      1 - 70
EFDNHINSYDHAHKQRLKELKQREFARNVASKSRKDERKQEKALQRLHKLAELRKETVCAPGSGPMFKST     71 - 140
TVTVRENCNEISQRVVVDSVNNQQDFKYTLIHSEENTKDATTVAEDPESANNYTAKNNQVGDQAQGIHRH    141 - 210
KIGFSFAFPKKASVKLESSAAAFSEYSDDASVGKGFSRKSRFVPSACHLQQSSPTDVLLSSEEKTNSFHP    211 - 280
PEAMCRDKETVQTQEIKEVSSEKDALLLPSFCKFQLQLSSDADNCQNSVPLADQIPLESVVINEDIPVSG    281 - 350
NSFELLGNKSTVLDMSNDCISVQATTEENVKHNEASTTEVENKNGPETLAPSNTEEVNITIHKKTNFCKR    351 - 420
QCEPFVPVLNKHRSTVLQWPSEMLVYTTTKPSISYSCNPLCFDFKSTKVNNNLDKNKPDLKDLCSQQKQE    421 - 490
DICMGPLSDYKDVSTEGLTDYEIGSSKNKCSQVTPLLADDILSSSCDSGKNENTGQRYKNISCKIRETEK    491 - 560
YNFTKSQIKQDTLDEKYNKIRLKETHEYWFHKSRRKKKRKKLCQHHHMEKTKESETRCKMEAENSYTENA    561 - 630
GKYLLEPISEKQYLAAEQLLDSHQLLDKRPKSESISLSDNEEMCKTWNTEYNTYDTISSKNHCKKNTILL    631 - 700
NGQSNATMIHSGKHNLTYSRTYCCWKTKMSSCSQDHRSLVLQNDMKHMSQNQAVKRGYNSVMNESERFYR    701 - 770
KRRQHSHSYSSDESLNRQNHLPEEFLRPPSTSVAPCKPKKKRRRKRGRFHPGFETLELKENTDYPVKDNS    771 - 840
SLNPLDRLISEDKKEKMKPQEVAKIERNSEQTNQLRNKLSFHPNNLLPSETNGETEHLEMETTSGELSDV    841 - 910
SNDPTTSVCVASAPTKEAIDNTLLEHKERSENINLNEKQIPFQVPNIERNFRQSQPKSYLCHYELAEALP    911 - 980
QGKMNETPTEWLRYNSGILNTQPPLPFKEAHVSGHTFVTAEQILAPLALPEQALLIPLENHDKFKNVPCE    981 - 1050
VYQHILQPNMLANKVKFTFPPAALPPPSTPLQPLPLQQSLCSTSVTTIHHTVLQQHAAAAAAAAAAAAAG   1051 - 1120
TFKVLQPHQQFLSQIPALTRTSLPQLSVGPVGPRLCPGNQPTFVAPPQMPIIPASVLHPSHLAFPSLPHA   1121 - 1190
LFPSLLSPHPTVIPLQPLF                                                      1191 - 1209
//

Text Mined References (94)

PMID Year Title
26934312 2016 No association between ZNF804A rs1344706 and schizophrenia in a case-control study of Han Chinese.
26670283 2015 Associations between the schizophrenia susceptibility gene ZNF804A and clinical outcomes in psychosis.
26654932 2016 Effect of rs1344706 in the ZNF804A gene on the connectivity between the hippocampal formation and posterior cingulate cortex.
26498712 2015 Genetics, sleep and memory: a recall-by-genotype study of ZNF804A variants and sleep neurophysiology.
26382569 2015 Replication of ZNF804A gene variant associations with risk of heroin addiction.
26164821 2015 Postnatal neurodevelopmental expression and glutamate-dependent regulation of the ZNF804A rodent homologue.
25935703 2016 ZNF804A Genetic Variation Confers Risk to Bipolar Disorder.
25921517 2015 ZNF804A rs1344706 is associated with cortical thickness, surface area, and cortical volume of the unmedicated first episode schizophrenia and healthy controls.
25905630 2015 ZNF804A Transcriptional Networks in Differentiating Neurons Derived from Induced Pluripotent Stem Cells of Human Origin.
25896933 2015 Elevated P3b latency variability in carriers of ZNF804A risk allele for psychosis.
More...