Property Summary

NCBI Gene PubMed Count 40
PubMed Score 19.87
PubTator Score 39.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Myocardial Infarction 151 0.0 0.0
Disease Target Count
Schizophrenia 1160
Disease Target Count P-value
osteosarcoma 7950 6.2e-09
malignant mesothelioma 3232 1.6e-06
ovarian cancer 8520 1.4e-05
Pick disease 1894 8.3e-05
medulloblastoma, large-cell 6241 2.8e-03
lung cancer 4740 1.1e-02
group 3 medulloblastoma 4104 3.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Celiac disease 116 0.0 2.3
Essential Hypertension 94 0.0 2.4
Hemolytic anemia 77 0.0 3.0

Expression

  Differential Expression (7)

Disease log2 FC p
group 3 medulloblastoma 1.100 3.4e-02
lung cancer 1.400 1.1e-02
malignant mesothelioma 1.200 1.6e-06
medulloblastoma, large-cell -1.100 2.8e-03
osteosarcoma -2.240 6.2e-09
ovarian cancer -1.200 1.4e-05
Pick disease 1.200 8.3e-05

Gene RIF (28)

AA Sequence

MSVSLVVIRLELAEHSPVPAGFGFSAAAGEMSDEEIKKTTLASAVACLEGKSPGEKVAIIHQHLGRREMT      1 - 70
DVIIETMKSNPDELKTTVEERKSSEASPTAQRSKDHSKECINAAPDSPSKQLPDQISFFSGNPSVEIVHG     71 - 140
IMHLYKTNKMTSLKEDVRRSAMLCILTVPAAMTSHDLMKFVAPFNEVIEQMKIIRDSTPNQYMVLIKFRA    141 - 210
QADADSFYMTCNGRQFNSIEDDVCQLVYVERAEVLKSEDGASLPVMDLTELPKCTVCLERMDESVNGILT    211 - 280
TLCNHSFHSQCLQRWDDTTCPVCRYCQTPEPVEENKCFECGVQENLWICLICGHIGCGRYVSRHAYKHFE    281 - 350
ETQHTYAMQLTNHRVWDYAGDNYVHRLVASKTDGKIVQYECEGDTCQEEKIDALQLEYSYLLTSQLESQR    351 - 420
IYWENKIVRIEKDTAEEINNMKTKFKETIEKCDNLEHKLNDLLKEKQSVERKCTQLNTKVAKLTNELKEE    421 - 490
QEMNKCLRANQVLLQNKLKEEERVLKETCDQKDLQITEIQEQLRDVMFYLETQQKINHLPAETRQEIQEG    491 - 560
QINIAMASASSPASSGGSGKLPSRKGRSKRGK                                          561 - 592
//

Text Mined References (49)

PMID Year Title