Property Summary

NCBI Gene PubMed Count 37
Grant Count 38
R01 Count 33
Funding $2,221,267.64
PubMed Score 16.48
PubTator Score 39.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
osteosarcoma -2.240 0.000
medulloblastoma, large-cell -1.100 0.003
lung cancer 1.400 0.011
group 3 medulloblastoma 1.100 0.034
Pick disease 1.200 0.000
ovarian cancer -1.400 0.000

Gene RIF (26)

PMID Text
25820252 Together the results indicate for the first time that BRAP2 may play an important NRNI role in germ cells of the testis, with an additional, scaffold/structural role in mature spermatozoa.
24454952 BRAP gene may confer vulnerability for schizophrenia in Han Chinese population.
23707952 ectopic expression of BRAP2 inhibits nuclear localization of HMG20A and NuMA1, and prevents nuclear envelope accumulation of SYNE2.
23554956 Brap2 regulates temporal control of NF-kappaB localization mediated by inflammatory response.
23526420 BAP1 expression closely correlates with age, clinical stage, pathologic differentiation and histological type in colorectal cancer (CRC). BAP1 may serve as a novel prognostic biomarker for CRC.
23356535 The BRAP polymorphism may not play an important role in ischemic stroke in the Taiwanese population.
23105109 The dominant effect of prolonged USP15 depletion upon signal amplitude is due to a decrease in CRAF levels while allowing for the possibility that USP15 may also function to dampen MAPK signaling through direct stabilization of BRAP.
22965072 genetic association studies in population of Chinese Han young adults in Beijing: Data suggest that 2 SNPs in BRAP (rs11066001; rs3782886) are associated with decreased risk of metabolic syndrome in this population.
22122968 ANRIL on 9p21 and BRAP were both associated with ankle brachial index in a Taiwanese population.
22085839 BRAP gene is associated with the extent of coronary atherosclerosis and has a synergistic effect with diabetes on the occurrence of significant CAD in the Chinese population
More...

AA Sequence

MSVSLVVIRLELAEHSPVPAGFGFSAAAGEMSDEEIKKTTLASAVACLEGKSPGEKVAIIHQHLGRREMT      1 - 70
DVIIETMKSNPDELKTTVEERKSSEASPTAQRSKDHSKECINAAPDSPSKQLPDQISFFSGNPSVEIVHG     71 - 140
IMHLYKTNKMTSLKEDVRRSAMLCILTVPAAMTSHDLMKFVAPFNEVIEQMKIIRDSTPNQYMVLIKFRA    141 - 210
QADADSFYMTCNGRQFNSIEDDVCQLVYVERAEVLKSEDGASLPVMDLTELPKCTVCLERMDESVNGILT    211 - 280
TLCNHSFHSQCLQRWDDTTCPVCRYCQTPEPVEENKCFECGVQENLWICLICGHIGCGRYVSRHAYKHFE    281 - 350
ETQHTYAMQLTNHRVWDYAGDNYVHRLVASKTDGKIVQYECEGDTCQEEKIDALQLEYSYLLTSQLESQR    351 - 420
IYWENKIVRIEKDTAEEINNMKTKFKETIEKCDNLEHKLNDLLKEKQSVERKCTQLNTKVAKLTNELKEE    421 - 490
QEMNKCLRANQVLLQNKLKEEERVLKETCDQKDLQITEIQEQLRDVMFYLETQQKINHLPAETRQEIQEG    491 - 560
QINIAMASASSPASSGGSGKLPSRKGRSKRGK                                          561 - 592
//

Text Mined References (46)

PMID Year Title
25820252 2015 Interactome of the negative regulator of nuclear import BRCA1-binding protein 2.
24916648 2015 A genome-wide association study identifies PLCL2 and AP3D1-DOT1L-SF3A2 as new susceptibility loci for myocardial infarction in Japanese.
24454952 2014 A two-stage association study suggests BRAP as a susceptibility gene for schizophrenia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23707952 2013 The BRCA1-binding protein BRAP2 can act as a cytoplasmic retention factor for nuclear and nuclear envelope-localizing testicular proteins.
23554956 2013 Brap2 regulates temporal control of NF-?B localization mediated by inflammatory response.
23526420 2013 Prognostic significance of BRCA1-associated protein 1 in colorectal cancer.
23356535 2013 Lack of association between a functional variant of the BRCA-1 related associated protein (BRAP) gene and ischemic stroke.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...