Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MAPFVRNLVEKTPALVNAAVTYLKPRLAAFWYYTTVELVPPTPAEIPRAIQSLKKIVSSAQTGSFKQLTV      1 - 70
KEALLNGLVATEVSTWFYVREITGKRGIIG                                             71 - 100
//

Text Mined References (3)

PMID Year Title