Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q7Z4Y8 ATPase subunit g 2
Symbols ATP5K2

Gene

AA Sequence

MAPFVRNLVEKTPALVNAAVTYLKPRLAAFWYYTTVELVPPTPAEIPRAIQSLKKIVSSAQTGSFKQLTV      1 - 70
KEALLNGLVATEVSTWFYVREITGKRGIIG                                             71 - 100
//

Text Mined References (3)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10361692 1999 Sequence of a cDNA encoding mouse F1F0-ATP synthase g subunit.