Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.55
PubTator Score 3.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Gene RIF (2)

PMID Text
23064961 We identified a significant genetic association between dental caries of the anterior mandibular teeth and LYZL2 (p value = 9e-9), which codes a bacteriolytic agent thought to be involved in host defense.
18984674 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKAAGILTLIGCLVTGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAQTVLDDGSI      1 - 70
DYGIFQINSFAWCRRGKLKENNHCHVACSALVTDDLTDAIICAKKIVKETQGMNYWQGWKKHCEGRDLSD     71 - 140
WKKDCEVS                                                                  141 - 148
//

Text Mined References (7)

PMID Year Title
23064961 2013 GWAS of dental caries patterns in the permanent dentition.
18984674 2009 KIF5B gene sequence variation and response of cardiac stroke volume to regular exercise.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16014814 2005 Molecular cloning and characterization of three novel lysozyme-like genes, predominantly expressed in the male reproductive system of humans, belonging to the c-type lysozyme/alpha-lactalbumin family.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.