Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.53
PubTator Score 3.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Dental caries 164 4.071 2.0
Disease Target Count Z-score Confidence
Aggressive Periodontitis 12 3.157 1.6

Gene RIF (2)

AA Sequence

MKAAGILTLIGCLVTGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAQTVLDDGSI      1 - 70
DYGIFQINSFAWCRRGKLKENNHCHVACSALVTDDLTDAIICAKKIVKETQGMNYWQGWKKHCEGRDLSD     71 - 140
WKKDCEVS                                                                  141 - 148
//

Text Mined References (7)

PMID Year Title