Property Summary

NCBI Gene PubMed Count 28
Grant Count 48
R01 Count 15
Funding $184,886,955.39
PubMed Score 1150.73
PubTator Score 43.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Rheumatoid Arthritis -1.100 0.011
atypical teratoid/rhabdoid tumor -1.400 0.000
adult high grade glioma -1.200 0.000
group 4 medulloblastoma -1.100 0.001
gastric carcinoma -1.200 0.035
ovarian cancer 1.900 0.000

Gene RIF (12)

PMID Text
23661708 EGCG is a potential inhibitor to human DCXR.
22042873 combined frequency of the two mutant DCXR alleles in 1,067 Ashkenazi Jewish controls was 0.0173, suggesting a pentosuria frequency of approximately one in 3,300 in this population
19337691 The action of human XR may be regulated by cellular redox conditions through reversible disulfide-bond formation and by S-cysteinylation.
18086765 DCXR overexpression has the potential to be an additional useful biomarker for prostate cancer.
18079483 DCXR trranfected into mice may function in the removal of renal alpha-dicarbonyl compounds under oxidative circumstances, but it is not sufficient to suppress acute renal fibrosis.
17576332 Decreased membranous expression of DCXR with altered subcellular localization appears to be associated with malignant progression of melanocytic lesions in human skin.
17434498 A significant proportion of men investigated for male infertility may be epididymal protein P34H deficient.
16847567 These results suggested that altered HCR2 expression might play roles in the carcinogenesis and progression of hepatocellular carcinoma.
16616743 Our results demonstrate that the proportion of positive P34H cases that produced embryos in vitro clearly differs from cases with undetectable levels of P34H (P<.001).
15906319 structure of the tetrameric form of human L-Xylulose reductase
More...

AA Sequence

MELFLAGRRVLVTGAGKGIGRGTVQALHATGARVVAVSRTQADLDSLVRECPGIEPVCVDLGDWEATERA      1 - 70
LGSVGPVDLLVNNAAVALLQPFLEVTKEAFDRSFEVNLRAVIQVSQIVARGLIARGVPGAIVNVSSQCSQ     71 - 140
RAVTNHSVYCSTKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQATWSDPHKAKTMLNRIPLGKFA    141 - 210
EVEHVVNAILFLLSDRSGMTTGSTLPVEGGFWAC                                        211 - 244
//

Text Mined References (35)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23661708 2013 (-)-Epigallocatechin-3-gallate, a potential inhibitor to human dicarbonyl/L-xylulose reductase.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23264731 2013 MTR120/KIAA1383, a novel microtubule-associated protein, promotes microtubule stability and ensures cytokinesis.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
More...