Property Summary

NCBI Gene PubMed Count 31
PubMed Score 1296.36
PubTator Score 43.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma -1.200 5.0e-04
atypical teratoid / rhabdoid tumor -1.100 7.9e-05
gastric carcinoma -1.200 3.5e-02
group 4 medulloblastoma -1.100 9.1e-04
ovarian cancer 1.900 5.6e-06
Rheumatoid arthritis -1.100 1.1e-02

Gene RIF (15)

AA Sequence

MELFLAGRRVLVTGAGKGIGRGTVQALHATGARVVAVSRTQADLDSLVRECPGIEPVCVDLGDWEATERA      1 - 70
LGSVGPVDLLVNNAAVALLQPFLEVTKEAFDRSFEVNLRAVIQVSQIVARGLIARGVPGAIVNVSSQCSQ     71 - 140
RAVTNHSVYCSTKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQATWSDPHKAKTMLNRIPLGKFA    141 - 210
EVEHVVNAILFLLSDRSGMTTGSTLPVEGGFWAC                                        211 - 244
//

Text Mined References (38)

PMID Year Title