Property Summary

NCBI Gene PubMed Count 15
PubMed Score 5.50
PubTator Score 104.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

Synonym

Accession Q7Z4V5 I3L080 K7EQZ6 Q96GI5 Q9BW08 HRP-2
Symbols HRP2
HDGF2
HRP-2
HDGF-2
HDGFRP2

Gene

PDB

3QBY   3EAE   3QJ6  

  Ortholog (1)

Species Source Disease
Mouse OMA Inparanoid

Gene RIF (8)

AA Sequence

MPHAFKPGDLVFAKMKGYPHWPARIDDIADGAVKPPPNKYPIFFFGTHETAFLGPKDLFPYDKCKDKYGK      1 - 70
PNKRKGFNEGLWEIQNNPHASYSAPPPVSSSDSEAPEANPADGSDADEDDEDRGVMAVTAVTATAASDRM     71 - 140
ESDSDSDKSSDNSGLKRKTPALKMSVSKRARKASSDLDQASVSPSEEENSESSSESEKTSDQDFTPEKKA    141 - 210
AVRAPRRGPLGGRKKKKAPSASDSDSKADSDGAKPEPVAMARSASSSSSSSSSSDSDVSVKKPPRGRKPA    211 - 280
EKPLPKPRGRKPKPERPPSSSSSDSDSDEVDRISEWKRRDEARRRELEARRRREQEEELRRLREQEKEEK    281 - 350
ERRRERADRGEAERGSGGSSGDELREDDEPVKKRGRKGRGRGPPSSSDSEPEAELEREAKKSAKKPQSSS    351 - 420
TEPARKPGQKEKRVRPEEKQQAKPVKVERTRKRSEGFSMDRKVEKKKEPSVEEKLQKLHSEIKFALKVDS    421 - 490
PDVKRCLNALEELGTLQVTSQILQKNTDVVATLKKIRRYKANKDVMEKAAEVYTRLKSRVLGPKIEAVQK    491 - 560
VNKAGMEKEKAEEKLAGEELAGEEAPQEKAEDKPSTDLSAPVNGEATSQKGESAEDKEHEEGRDSEEGPR    561 - 630
CGSSEDLHDSVREGPDLDRPGSDRQERERARGDSEALDEES                                 631 - 671
//

Text Mined References (20)

PMID Year Title