Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.83
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 1.04404650073586E-10
atypical teratoid / rhabdoid tumor 4369 5.64642067326753E-9
medulloblastoma 1524 3.44279666830414E-8
glioblastoma 5572 5.66603262299234E-6
pilocytic astrocytoma 3086 5.24227430822607E-5
primitive neuroectodermal tumor 3031 1.03403041981201E-4
pediatric high grade glioma 2712 7.08937880415237E-4
medulloblastoma, large-cell 6234 9.48698025119585E-4
astrocytic glioma 2241 0.00906882108952002
ependymoma 2514 0.019740028624097
oligodendroglioma 2849 0.025027761322397
Disease Target Count Z-score Confidence
Male infertility 170 3.253 1.6

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -2.700 0.009
ependymoma -2.800 0.020
oligodendroglioma -2.400 0.025
glioblastoma -1.900 0.000
medulloblastoma -2.000 0.000
atypical teratoid / rhabdoid tumor -1.900 0.000
medulloblastoma, large-cell -2.000 0.001
primitive neuroectodermal tumor -1.900 0.000
pediatric high grade glioma -1.300 0.001
pilocytic astrocytoma -1.500 0.000
psoriasis -2.600 0.000

Synonym

Accession Q7Z4T8 Q75KN2 Q75MD3 Q8NCV4 Q8WW05 Q9UDR9
Symbols GALNT15
GALNACT19
GalNAc-T5L

Gene

PANTHER Protein Class (2)

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG

AA Sequence

MRNAIIQGLFYGSLTFGIWTALLFIYLHHNHVSSWQKKSQEPLSAWSPGKKVHQQIIYGSEQIPKPHVIV      1 - 70
KRTDEDKAKSMLGTDFNHTNPELHKELLKYGFNVIISRSLGIEREVPDTRSKMCLQKHYPARLPTASIVI     71 - 140
CFYNEECNALFQTMSSVTNLTPHYFLEEIILVDDMSKVDDLKEKLDYHLETFRGKVKIIRNKKREGLIRA    141 - 210
RLIGASHASGDVLVFLDSHCEVNRVWLEPLLHAIAKDPKMVVCPLIDVIDDRTLEYKPSPLVRGTFDWNL    211 - 280
QFKWDNVFSYEMDGPEGSTKPIRSPAMSGGIFAIRRHYFNEIGQYDKDMDFWGRENLELSLRIWMCGGQL    281 - 350
FIIPCSRVGHISKKQTGKPSTIISAMTHNYLRLVHVWLDEYKEQFFLRKPGLKYVTYGNIRERVELRKRL    351 - 420
GCKSFQWYLDNVFPELEASVNSL                                                   421 - 443
//

Text Mined References (9)

PMID Year Title
24398516 2014 A heterozygous mutation of GALNTL5 affects male infertility with impairment of sperm motility.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9847074 1998 Toward a complete human genome sequence.