Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.83
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -2.700 0.009
ependymoma -2.800 0.020
oligodendroglioma -2.400 0.025
glioblastoma -1.900 0.000
medulloblastoma -2.000 0.000
atypical teratoid / rhabdoid tumor -1.900 0.000
medulloblastoma, large-cell -2.000 0.001
primitive neuroectodermal tumor -1.900 0.000
pediatric high grade glioma -1.300 0.001
pilocytic astrocytoma -1.500 0.000
psoriasis -2.600 0.000

Synonym

Accession Q7Z4T8 Q75KN2 Q75MD3 Q8NCV4 Q8WW05 Q9UDR9
Symbols GALNT15
GALNACT19
GalNAc-T5L

Gene

PANTHER Protein Class (2)

AA Sequence

MRNAIIQGLFYGSLTFGIWTALLFIYLHHNHVSSWQKKSQEPLSAWSPGKKVHQQIIYGSEQIPKPHVIV      1 - 70
KRTDEDKAKSMLGTDFNHTNPELHKELLKYGFNVIISRSLGIEREVPDTRSKMCLQKHYPARLPTASIVI     71 - 140
CFYNEECNALFQTMSSVTNLTPHYFLEEIILVDDMSKVDDLKEKLDYHLETFRGKVKIIRNKKREGLIRA    141 - 210
RLIGASHASGDVLVFLDSHCEVNRVWLEPLLHAIAKDPKMVVCPLIDVIDDRTLEYKPSPLVRGTFDWNL    211 - 280
QFKWDNVFSYEMDGPEGSTKPIRSPAMSGGIFAIRRHYFNEIGQYDKDMDFWGRENLELSLRIWMCGGQL    281 - 350
FIIPCSRVGHISKKQTGKPSTIISAMTHNYLRLVHVWLDEYKEQFFLRKPGLKYVTYGNIRERVELRKRL    351 - 420
GCKSFQWYLDNVFPELEASVNSL                                                   421 - 443
//

Text Mined References (9)

PMID Year Title
24398516 2014 A heterozygous mutation of GALNTL5 affects male infertility with impairment of sperm motility.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9847074 1998 Toward a complete human genome sequence.