Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.53
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.100 2.6e-02
astrocytic glioma -2.700 9.1e-03
Astrocytoma, Pilocytic -1.500 3.3e-05
atypical teratoid / rhabdoid tumor -1.900 5.6e-09
ependymoma -2.800 2.0e-02
glioblastoma -1.100 7.0e-04
group 4 medulloblastoma -1.300 9.2e-03
medulloblastoma, large-cell -2.000 9.5e-04
oligodendroglioma -2.400 2.5e-02
primitive neuroectodermal tumor -1.900 1.0e-04
psoriasis -2.600 1.0e-10

AA Sequence

MRNAIIQGLFYGSLTFGIWTALLFIYLHHNHVSSWQKKSQEPLSAWSPGKKVHQQIIYGSEQIPKPHVIV      1 - 70
KRTDEDKAKSMLGTDFNHTNPELHKELLKYGFNVIISRSLGIEREVPDTRSKMCLQKHYPARLPTASIVI     71 - 140
CFYNEECNALFQTMSSVTNLTPHYFLEEIILVDDMSKVDDLKEKLDYHLETFRGKVKIIRNKKREGLIRA    141 - 210
RLIGASHASGDVLVFLDSHCEVNRVWLEPLLHAIAKDPKMVVCPLIDVIDDRTLEYKPSPLVRGTFDWNL    211 - 280
QFKWDNVFSYEMDGPEGSTKPIRSPAMSGGIFAIRRHYFNEIGQYDKDMDFWGRENLELSLRIWMCGGQL    281 - 350
FIIPCSRVGHISKKQTGKPSTIISAMTHNYLRLVHVWLDEYKEQFFLRKPGLKYVTYGNIRERVELRKRL    351 - 420
GCKSFQWYLDNVFPELEASVNSL                                                   421 - 443
//

Text Mined References (10)

PMID Year Title