Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.10
PubTator Score 1.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.200 5.8e-05
cutaneous lupus erythematosus 1.100 4.9e-03
hepatocellular carcinoma 1.100 7.2e-06
medulloblastoma, large-cell -1.300 6.7e-04
ovarian cancer -2.000 1.0e-08
pancreatic ductal adenocarcinoma liver m... -1.015 4.2e-02
Pick disease -1.100 1.2e-03
psoriasis 1.300 1.4e-03

Gene RIF (1)

AA Sequence

MAAPRGRAAPWTTALLLLLASQVLSPGSCADEEEVPEEWVLLHVVQGQIGAGNYSYLRLNHEGKIVLRMR      1 - 70
SLKGDADLYVSASSLHPSFDDYELQSATCGPDAVSIPAHFRRPVGIGVYGHPSHLESEFEMKVYYDGTVE     71 - 140
QHPFGEAAYPADGADAGQKHAGAPEDASQEEESVLWTILISILKLVLEILF                       141 - 191
//

Text Mined References (12)

PMID Year Title