Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.10
PubTator Score 1.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Gene RIF (1)

PMID Text
22340178 Results suggested that C6ORF120 could induce apoptosis of CD4(+) T cells, at least in part, mediated with endoplasmic reticulum stress.

AA Sequence

MAAPRGRAAPWTTALLLLLASQVLSPGSCADEEEVPEEWVLLHVVQGQIGAGNYSYLRLNHEGKIVLRMR      1 - 70
SLKGDADLYVSASSLHPSFDDYELQSATCGPDAVSIPAHFRRPVGIGVYGHPSHLESEFEMKVYYDGTVE     71 - 140
QHPFGEAAYPADGADAGQKHAGAPEDASQEEESVLWTILISILKLVLEILF                       141 - 191
//

Text Mined References (12)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22340178 2011 Role of C6ORF120, an N-glycosylated protein, is implicated in apoptosis of CD4? T lymphocytes.
21980299 2011 A genome-wide meta-analysis of six type 1 diabetes cohorts identifies multiple associated loci.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9110174 1997 Large-scale concatenation cDNA sequencing.
More...