Property Summary

NCBI Gene PubMed Count 16
Grant Count 35
R01 Count 10
Funding $3,599,824.51
PubMed Score 36.14
PubTator Score 18.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Chronic Lymphocytic Leukemia 1.587 0.011
psoriasis -1.200 0.000
osteosarcoma -2.028 0.000
group 4 medulloblastoma 1.100 0.008

 GO Component (1)

Gene RIF (9)

PMID Text
25447851 closest protein-coding genes were respectively GDF7 (rs3072), which encodes a ligand in the bone morphogenetic protein pathway, and TBX5 (rs2701108), which encodes a transcription factor that regulates esophageal and cardiac development
24155967 BMP12 induces tenogenic differentiation of adipose-derived stromal cells via the Smad1/5/8 pathway.
21702718 studies show that even though tenogenic (BMP 12 and BMP 13) and osteogenic (BMP2) BMPs bind the same receptors with high affinity they signal much differently and result in differential activation of osteogenic and tenogenic markers
20734064 Observational study of gene-disease association. (HuGE Navigator)
20677014 Observational study of gene-disease association. (HuGE Navigator)
20334610 induces ligamentogenic differentiation in mesenchymal progenitors
20237496 Observational study of gene-disease association. (HuGE Navigator)
20102312 stimulates expression of both chondrogenic and osteoblstic markers in pluripotent mesenchymal C3H10T1/2 cells.
12741987 In mouse, the expression of Gdf7 in roof plate cells is required for the fidelity of commissural axon growth.

AA Sequence

MDLSAAAALCLWLLSACRPRDGLEAAAVLRAAGAGPVRSPGGGGGGGGGGRTLAQAAGAAAVPAAAVPRA      1 - 70
RAARRAAGSGFRNGSVVPHHFMMSLYRSLAGRAPAGAAAVSASGHGRADTITGFTDQATQDESAAETGQS     71 - 140
FLFDVSSLNDADEVVGAELRVLRRGSPESGPGSWTSPPLLLLSTCPGAARAPRLLYSRAAEPLVGQRWEA    141 - 210
FDVADAMRRHRREPRPPRAFCLLLRAVAGPVPSPLALRRLGFGWPGGGGSAAEERAVLVVSSRTQRKESL    211 - 280
FREIRAQARALGAALASEPLPDPGTGTASPRAVIGGRRRRRTALAGTRTAQGSGGGAGRGHGRRGRSRCS    281 - 350
RKPLHVDFKELGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARL    351 - 420
SPISILYIDAANNVVYKQYEDMVVEACGCR                                            421 - 450
//

Text Mined References (17)

PMID Year Title
26783083 2016 The Barrett-associated variants at GDF7 and TBX5 also increase esophageal adenocarcinoma risk.
26445383 2016 Effect of adipose-derived stromal cells and BMP12 on intrasynovial tendon repair: A biomechanical, biochemical, and proteomics study.
26033972 2015 Local rhBMP-12 on an Absorbable Collagen Sponge as an Adjuvant Therapy for Rotator Cuff Repair - A Phase 1, Randomized, Standard of Care Control, Multicenter Study: Safety and Feasibility.
25447851 2015 Polymorphisms near TBX5 and GDF7 are associated with increased risk for Barrett's esophagus.
24155967 2013 BMP12 induces tenogenic differentiation of adipose-derived stromal cells.
21702718 2011 Divergent activities of osteogenic BMP2, and tenogenic BMP12 and BMP13 independent of receptor binding affinities.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20339536 2010 Genome-wide association of lipid-lowering response to statins in combined study populations.
20334610 2010 BMP12 and BMP13 gene transfer induce ligamentogenic differentiation in mesenchymal progenitor and anterior cruciate ligament cells.
More...