Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.86
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (9)

Disease log2 FC p
fibroadenoma 1.400 1.8e-02
glioblastoma 1.200 1.3e-02
inflammatory breast cancer 1.200 8.5e-03
interstitial cystitis 1.800 1.1e-03
invasive ductal carcinoma 1.352 1.2e-05
lung adenocarcinoma 1.400 3.8e-06
osteosarcoma 1.372 1.3e-02
ovarian cancer -1.100 1.2e-05
X-linked cerebral adrenoleukodystrophy 1.400 1.0e-03

Gene RIF (3)

AA Sequence

MGPGARLAALLAVLALGTGDPERAAARGDTFSALTSVARALAPERRLLGLLRRYLRGEEARLRDLTRFYD      1 - 70
KVLSLHEDSTTPVANPLLAFTLIKRLQSDWRNVVHSLEASENIRALKDGYEKVEQDLPAFEDLEGAARAL     71 - 140
MRLQDVYMLNVKGLARGVFQRVTGSAITDLYSPKRLFSLTGDDCFQVGKVAYDMGDYYHAIPWLEEAVSL    141 - 210
FRGSYGEWKTEDEASLEDALDHLAFAYFRAGNVSCALSLSREFLLYSPDNKRMARNVLKYERLLAESPNH    211 - 280
VVAEAVIQRPNIPHLQTRDTYEGLCQTLGSQPTLYQIPSLYCSYETNSNAYLLLQPIRKEVIHLEPYIAL    281 - 350
YHDFVSDSEAQKIRELAEPWLQRSVVASGEKQLQVEYRISKSAWLKDTVDPKLVTLNHRIAALTGLDVRP    351 - 420
PYAEYLQVVNYGIGGHYEPHFDHATSPSSPLYRMKSGNRVATFMIYLSSVEAGGATAFIYANLSVPVVRN    421 - 490
AALFWWNLHRSGEGDSDTLHAGCPVLVGDKWVANKWIHEYGQEFRRPCSSSPED                    491 - 544
//

Text Mined References (12)

PMID Year Title