Property Summary

NCBI Gene PubMed Count 3
PubMed Score 2.49
PubTator Score 3.48

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q7Z4L9
Symbols dtr
TLLR
TLRR
LRRC67

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MVRLTLDLIARNSNLKPRKEETISQCLKKITHINFSDKNIDAIEDLSLCKNLSVLYLYDNCISQITNLNY      1 - 70
ATNLTHLYLQNNCISCIENLRSLKKLEKLYLGGNYIAVIEGLEGLGELRELHVENQRLPLGEKLLFDPRT     71 - 140
LHSLAKSLCILNISNNNIDDITDLELLENLNQLIAVDNQLLHVKDLEFLLNKLMKLWKIDLNGNPVCLKP    141 - 210
KYRDRLILVSKSLEFLDGKEIKNIERQFLMNWKASKDAKKISKKRSSKNEDASNSLISNFKTMHHIVPVY    211 - 280
YPQVGKPKLAFFSEIQRYPVNANASPESSEDYTKIIEMGNLSLKQSESLLTKNDVHEPHLFHNPEEKENL    281 - 350
FVENE                                                                     351 - 355
//

Text Mined References (5)

PMID Year Title