Property Summary

NCBI Gene PubMed Count 2
Grant Count 12
R01 Count 4
Funding $614,083.8
PubMed Score 2.39
PubTator Score 3.48

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
23718219 PPP1R42 regulation of PP1 function in centrosome separation.
18976975 Knockdown of protein phosphatase 1, regulatory subunit 42 (PPP1R42) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MVRLTLDLIARNSNLKPRKEETISQCLKKITHINFSDKNIDAIEDLSLCKNLSVLYLYDNCISQITNLNY      1 - 70
ATNLTHLYLQNNCISCIENLRSLKKLEKLYLGGNYIAVIEGLEGLGELRELHVENQRLPLGEKLLFDPRT     71 - 140
LHSLAKSLCILNISNNNIDDITDLELLENLNQLIAVDNQLLHVKDLEFLLNKLMKLWKIDLNGNPVCLKP    141 - 210
KYRDRLILVSKSLEFLDGKEIKNIERQFLMNWKASKDAKKISKKRSSKNEDASNSLISNFKTMHHIVPVY    211 - 280
YPQVGKPKLAFFSEIQRYPVNANASPESSEDYTKIIEMGNLSLKQSESLLTKNDVHEPHLFHNPEEKENL    281 - 350
FVENE                                                                     351 - 355
//

Text Mined References (4)

PMID Year Title
23718219 2013 PPP1R42, a PP1 binding protein, regulates centrosome dynamics in ARPE-19 cells.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.