Property Summary

NCBI Gene PubMed Count 3
PubMed Score 2.49
PubTator Score 3.48

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

AA Sequence

MVRLTLDLIARNSNLKPRKEETISQCLKKITHINFSDKNIDAIEDLSLCKNLSVLYLYDNCISQITNLNY      1 - 70
ATNLTHLYLQNNCISCIENLRSLKKLEKLYLGGNYIAVIEGLEGLGELRELHVENQRLPLGEKLLFDPRT     71 - 140
LHSLAKSLCILNISNNNIDDITDLELLENLNQLIAVDNQLLHVKDLEFLLNKLMKLWKIDLNGNPVCLKP    141 - 210
KYRDRLILVSKSLEFLDGKEIKNIERQFLMNWKASKDAKKISKKRSSKNEDASNSLISNFKTMHHIVPVY    211 - 280
YPQVGKPKLAFFSEIQRYPVNANASPESSEDYTKIIEMGNLSLKQSESLLTKNDVHEPHLFHNPEEKENL    281 - 350
FVENE                                                                     351 - 355
//

Text Mined References (5)

PMID Year Title