Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.88
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Tethered spinal cord syndrome 11 5.247 2.6

Expression

Synonym

Accession Q7Z4L0 Q495K7
Symbols COX8-3

Gene

PANTHER Protein Class (2)

Gene RIF (2)

PMID Text
22419111 Tat-induced mitochondrial membrane permeabilization is associated with inhibition of cytochrome c oxidase (COX) activity by Tat in disrupted mitochondria from human samples
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPLLRGRCPARRHYRRLALLGLQPAPRFAHSGPPRQRPLSAAEMAVGLVVFFTTFLTPAAYVLGNLKQFR      1 - 70
RN                                                                         71 - 72
//

Text Mined References (5)

PMID Year Title
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12909344 2003 A third isoform of cytochrome c oxidase subunit VIII is present in mammals.
12762575 2003 Genetic aspects of susceptibility to air pollution.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.