Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.88
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Tethered spinal cord syndrome 11 5.186 2.6

Expression

Gene RIF (2)

AA Sequence

MPLLRGRCPARRHYRRLALLGLQPAPRFAHSGPPRQRPLSAAEMAVGLVVFFTTFLTPAAYVLGNLKQFR      1 - 70
RN                                                                         71 - 72
//

Text Mined References (5)

PMID Year Title