Property Summary

NCBI Gene PubMed Count 18
PubMed Score 2.89
PubTator Score 7.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis -1.100 0.000
cystic fibrosis -1.444 0.000
non-small cell lung cancer -2.141 0.000
lung cancer -1.200 0.005
breast carcinoma -1.400 0.000
lung adenocarcinoma -2.000 0.000
non-inflammatory breast cancer -1.200 0.021
ductal carcinoma in situ -1.400 0.000
invasive ductal carcinoma -1.700 0.000

Synonym

Accession Q7Z4I7 A6NLH0 B4DMV1 F5H6E6 Q7Z4I2 Q7Z4I6 Q7Z4I8 Q8NFE7 Q9HA13
Symbols LGMD2W
PINCH2
PINCH-2

Gene

PDB

3IXE  

Gene RIF (6)

PMID Text
25589244 Data indicate compound heterozygous missense mutations that are predicted to be pathogenic in LIM and senescent cell antigen-like domains 2 protein (LIMS2).
25346044 Results defined the functional role of copy number variations involving PINCH-2 in cancer progression based on the field cancerization effect; cell migration and invasion through autocrine and paracrine function as part of the field cancerization effect.
20500520 PINCH-2 mRNA is overexpressed in malignant mesothelioma
20237496 Observational study of gene-disease association. (HuGE Navigator)
16959213 LIMS2 may be useful as a molecular biomarker and a therapeutic target by increasing its expression and activity in gastric cancer
12167643 These results identify a novel nuclear and focal adhesion protein that associates with ILK and reveals an important role of PINCH-2 in the regulation of the PINCH-1-ILK interaction, cell shape change, and migration.

AA Sequence

MTGSNMSDALANAVCQRCQARFSPAERIVNSNGELYHEHCFVCAQCFRPFPEGLFYEFEGRKYCEHDFQM      1 - 70
LFAPCCGSCGEFIIGRVIKAMNNNWHPGCFRCELCDVELADLGFVKNAGRHLCRPCHNREKAKGLGKYIC     71 - 140
QRCHLVIDEQPLMFRSDAYHPDHFNCTHCGKELTAEARELKGELYCLPCHDKMGVPICGACRRPIEGRVV    141 - 210
NALGKQWHVEHFVCAKCEKPFLGHRHYEKKGLAYCETHYNQLFGDVCYNCSHVIEGDVVSALNKAWCVSC    211 - 280
FSCSTCNSKLTLKNKFVEFDMKPVCKRCYEKFPLELKKRLKKLSELTSRKAQPKATDLNSA             281 - 341
//

Text Mined References (22)

PMID Year Title
25589244 2015 LIMS2 mutations are associated with a novel muscular dystrophy, severe cardiomyopathy and triangular tongues.
25416956 2014 A proteome-scale map of the human interactome network.
25346044 2015 PINCH-2 presents functional copy number variation and suppresses migration of colon cancer cells by paracrine activity.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23535033 2014 Genome-wide association study of the rate of cognitive decline in Alzheimer's disease.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
20500520 2011 PINCH-2 expression in cancers involving serosal effusions using quantitative PCR.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19963065 2010 Structural basis of competition between PINCH1 and PINCH2 for binding to the ankyrin repeat domain of integrin-linked kinase.
More...