Property Summary

NCBI Gene PubMed Count 19
PubMed Score 2.85
PubTator Score 7.71

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
breast carcinoma -1.400 1.7e-05
cystic fibrosis -1.444 1.3e-05
ductal carcinoma in situ -1.400 1.3e-05
invasive ductal carcinoma -1.700 6.1e-05
lung adenocarcinoma -2.000 5.3e-13
lung cancer -1.200 5.2e-03
non-inflammatory breast cancer -1.200 2.1e-02
non-small cell lung cancer -2.141 3.2e-29
psoriasis -1.100 8.8e-08

Protein-protein Interaction (1)

Gene RIF (7)

AA Sequence

MTGSNMSDALANAVCQRCQARFSPAERIVNSNGELYHEHCFVCAQCFRPFPEGLFYEFEGRKYCEHDFQM      1 - 70
LFAPCCGSCGEFIIGRVIKAMNNNWHPGCFRCELCDVELADLGFVKNAGRHLCRPCHNREKAKGLGKYIC     71 - 140
QRCHLVIDEQPLMFRSDAYHPDHFNCTHCGKELTAEARELKGELYCLPCHDKMGVPICGACRRPIEGRVV    141 - 210
NALGKQWHVEHFVCAKCEKPFLGHRHYEKKGLAYCETHYNQLFGDVCYNCSHVIEGDVVSALNKAWCVSC    211 - 280
FSCSTCNSKLTLKNKFVEFDMKPVCKRCYEKFPLELKKRLKKLSELTSRKAQPKATDLNSA             281 - 341
//

Text Mined References (23)

PMID Year Title