Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.25
PubTator Score 0.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Breast cancer 2.100 4.8e-02
medulloblastoma, large-cell -1.100 1.1e-03
non-small cell lung cancer 1.016 4.8e-19
ovarian cancer -1.600 6.7e-09
subependymal giant cell astrocytoma -1.374 9.6e-03
tuberculosis and treatment for 6 months -1.100 1.5e-05

Synonym

Accession Q7Z4H9 Q75ML2 Q8NA52 Q9BRR7
Symbols SIPAR
ACPIN1
C7orf70

Gene

  Ortholog (1)

Species Source Disease
Macaque EggNOG Inparanoid

Gene RIF (1)

AA Sequence

MRDRRGPLGTCLAQVQQAGGGDSDKLSCSLKKRMPEGPWPADAPSWMNKPVVDGNSQSEALSLEMRKDPS      1 - 70
GAGLWLHSGGPVLPYVRESVRRNPASAATPSTAVGLFPAPTECFARVSCSGVEALGRRDWLGGGPRATDG     71 - 140
HRGQCPKGEPRVSRLPRHQKVPEMGSFQDDPPSAFPKGLGSELEPACLHSILSATLHVYPEVLLSEETKR    141 - 210
IFLDRLKPMFSKQTIEFKKMLKSTSDGLQITLGLLALQPFELANTLCHS                         211 - 259
//

Text Mined References (8)

PMID Year Title