Property Summary

NCBI Gene PubMed Count 24
PubMed Score 5.75
PubTator Score 7.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adrenocortical carcinoma 1.049 4.8e-04
atypical teratoid / rhabdoid tumor 1.800 2.0e-06
ependymoma 1.500 9.1e-10
glioblastoma 1.500 2.2e-05
group 3 medulloblastoma 1.400 1.6e-03
juvenile dermatomyositis 1.065 7.5e-10
medulloblastoma, large-cell 2.200 3.8e-07
non-small cell lung cancer 1.005 2.2e-07
osteosarcoma 1.444 9.2e-03
ovarian cancer -1.200 1.0e-02
pediatric high grade glioma 1.600 2.6e-04
pituitary cancer 1.400 1.4e-05
primitive neuroectodermal tumor 1.500 1.2e-03

Gene RIF (4)

AA Sequence

MSSASVTAFEKEHLWMYLQALGFEPGPATIACGKIVSHTHLGVNMFDKLNRDAFHIISYFLFQVLDQSLT      1 - 70
KEVFKFCWPPFDQKSDTEFRKHCCEWIKRISGECGSSFPQVVGSLFLSPGGPKFIHLMYHFARFVAMKYI     71 - 140
KSNSKNSSHHFVETFNIKPQDLHKCIARCHFARSRFLQILQRQDCVTQKYQENAQLSVKQVRNLRSECIG    141 - 210
LENQIKKMEPYDDHSNMEEKIQKVRSLWASVNETLMFLEKEREVVSSVLSLVNQYALDGTNVAINIPRLL    211 - 280
LDKIEKQMFQLHIGNVYEAGKLNLLTVIQLLNEVLKVMKYERCQADQARLTVDLHYLEKETKFQKERLSD    281 - 350
LKHMRYRIKDDLTTIRHSVVEKQGEWHKKWKEFLGLSPFSLIKGWTPSVDLLPPMSPLSFDPASEEVYAK    351 - 420
SILCQYPASLPDAHKQHNQENGCRGDSDTLGALHDLANSPASFLSQSVSSSDRNSVTVLEKDTKMGTPKE    421 - 490
KNEAISKKIPEFEVENSPLSDVAKNTESSAFGGSLPAKKSDPFQKEQDHLVEEVARAVLSDSPQLSEGKE    491 - 560
IKLEELIDSLGSNPFLTRNQIPRTPENLITEIRSSWRKAIEMEENRTKEPIQMDAEHREVLPESLPVLHN    561 - 630
QREFSMADFLLETTVSDFGQSHLTEEKVISDCECVPQKHVLTSHIDEPPTQNQSDLLNKKVICKQDLECL    631 - 700
AFTKLSETSRMETFSPAVGNRIDVMGGSEEEFMKILDHLEVSCNKPSTNKTMLWNSFQISSGISSKSFKD    701 - 770
NDFGILHETLPEEVGHLSFNSSSSSEANFKLEPNSPMHGGTLLEDVVGGRQTTPESDFNLQALRSRYEAL    771 - 840
KKSLSKKREESYLSNSQTPERHKPELSPTPQNVQTDDTLNFLDTCDLHTEHIKPSLRTSIGERKRSLSPL    841 - 910
IKFSPVEQRLRTTIACSLGELPNLKEEDILNKSLDAKEPPSDLTR                             911 - 955
//

Text Mined References (33)

PMID Year Title