Property Summary

NCBI Gene PubMed Count 22
PubMed Score 5.42
PubTator Score 7.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Gene RIF (4)

PMID Text
25173975 Hice1 and hDgt6 are core components of distinct augmin sub-complexes.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19029337 FAM29A promotes microtubule amplification via recruitment of the NEDD1-gamma-tubulin complex to the mitotic spindle.
18443220 Results suggest that an important mitotic function for gamma-tubulin may lie within the spindle, where augmin (Dgt2-6; FAM29A) and gamma-tubulin function cooperatively to amplify the number of microtubules.

AA Sequence

MSSASVTAFEKEHLWMYLQALGFEPGPATIACGKIVSHTHLGVNMFDKLNRDAFHIISYFLFQVLDQSLT      1 - 70
KEVFKFCWPPFDQKSDTEFRKHCCEWIKRISGECGSSFPQVVGSLFLSPGGPKFIHLMYHFARFVAMKYI     71 - 140
KSNSKNSSHHFVETFNIKPQDLHKCIARCHFARSRFLQILQRQDCVTQKYQENAQLSVKQVRNLRSECIG    141 - 210
LENQIKKMEPYDDHSNMEEKIQKVRSLWASVNETLMFLEKEREVVSSVLSLVNQYALDGTNVAINIPRLL    211 - 280
LDKIEKQMFQLHIGNVYEAGKLNLLTVIQLLNEVLKVMKYERCQADQARLTVDLHYLEKETKFQKERLSD    281 - 350
LKHMRYRIKDDLTTIRHSVVEKQGEWHKKWKEFLGLSPFSLIKGWTPSVDLLPPMSPLSFDPASEEVYAK    351 - 420
SILCQYPASLPDAHKQHNQENGCRGDSDTLGALHDLANSPASFLSQSVSSSDRNSVTVLEKDTKMGTPKE    421 - 490
KNEAISKKIPEFEVENSPLSDVAKNTESSAFGGSLPAKKSDPFQKEQDHLVEEVARAVLSDSPQLSEGKE    491 - 560
IKLEELIDSLGSNPFLTRNQIPRTPENLITEIRSSWRKAIEMEENRTKEPIQMDAEHREVLPESLPVLHN    561 - 630
QREFSMADFLLETTVSDFGQSHLTEEKVISDCECVPQKHVLTSHIDEPPTQNQSDLLNKKVICKQDLECL    631 - 700
AFTKLSETSRMETFSPAVGNRIDVMGGSEEEFMKILDHLEVSCNKPSTNKTMLWNSFQISSGISSKSFKD    701 - 770
NDFGILHETLPEEVGHLSFNSSSSSEANFKLEPNSPMHGGTLLEDVVGGRQTTPESDFNLQALRSRYEAL    771 - 840
KKSLSKKREESYLSNSQTPERHKPELSPTPQNVQTDDTLNFLDTCDLHTEHIKPSLRTSIGERKRSLSPL    841 - 910
IKFSPVEQRLRTTIACSLGELPNLKEEDILNKSLDAKEPPSDLTR                             911 - 955
//

Text Mined References (31)

PMID Year Title
25173975 2014 Reconstitution of the augmin complex provides insights into its architecture and function.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22239941 2012 A genome wide association study of pulmonary tuberculosis susceptibility in Indonesians.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19427217 2009 HAUS, the 8-subunit human Augmin complex, regulates centrosome and spindle integrity.
More...