Property Summary

NCBI Gene PubMed Count 43
Grant Count 29
R01 Count 18
Funding $1,963,619.81
PubMed Score 311.55
PubTator Score 162.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.100 0.001

Gene RIF (29)

PMID Text
26743504 Intermedin (IMD) derived from human cardiac microvascular endothelial cell and acting in a paracrine manner on cardiomyocytes, predominantly at AM1 receptors, is more likely to contribute to direct protection by endogenous IMD of cardiomyocytes against acute ischemia reperfusion injury.
26510869 ADM2 may contribute to the physiology of embryo implantation and placental growth via increasing MMP2 and decreasing MUC1 expression to facilitate trophoblast invasion.
26406405 Elevated plasma intermedin levels are independently associated with long-term recurrence and distant metastasis of prostate cancer.
25982376 High levels of ADM2 expression predict a poorer survival in patients with pancreatic adenocarcinoma.
25637664 Intermedin affects the endothelial cell junction and blood vessel sprouting in a VE-cadherin dependent way.
25102228 TSH induced AM2/IMD expression in the thyroid gland and it could locally work as a potent vasodilator, resulting in the expansion of thyroid inter-follicular capillaries.
24969626 results suggest that high plasma intermedin level is associated with poor outcomes of patients and may be a useful prognostic biomarker in ST-segment elevation acute myocardial infarction.
24531032 ADM and IMD mRNA expression are elevated in chronic heart failure at different stages of the disease.
23499766 a significant increase in plasma intermedin following acute myocardial infarction may be associated with oxidative stress, and could be used as a marker to reflect the severity of the coronary stenosis
23391507 Plasma intermedin and BNP levels were markedly higher in acute coronary syndrome patients than in healthy people.
More...

AA Sequence

MARIPTAALGCISLLCLQLPGSLSRSLGGDPRPVKPREPPARSPSSSLQPRHPAPRPVVWKLHRALQAQR      1 - 70
GAGLAPVMGQPLRDGGRQHSGPRRHSGPRRTQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVD     71 - 140
PSSPHSYG                                                                  141 - 148
//

Text Mined References (43)

PMID Year Title
26743504 2016 Endothelium-derived intermedin/adrenomedullin-2 protects human ventricular cardiomyocytes from ischaemia-reoxygenation injury predominantly via the AM? receptor.
26510869 2015 Adrenomedullin 2 (ADM2) Regulates Mucin 1 at the Maternal-Fetal Interface in Human Pregnancy.
26406405 2015 Association of plasma intermedin levels with progression and metastasis in men after radical prostatectomy for localized prostatic cancer.
25982376 2015 The novel tumor angiogenic factor, adrenomedullin-2, predicts survival in pancreatic adenocarcinoma.
25637664 2015 Intermedin restricts vessel sprouting by inhibiting the loosening of endothelial junction.
25102228 2014 Induction of adrenomedullin 2/intermedin expression by thyroid stimulating hormone in thyroid.
24969626 2014 Intermedin as a prognostic factor for major adverse cardiovascular events in patients with ST-segment elevation acute myocardial infarction.
24531032 2014 Adrenomedullin and intermedin gene transcription is increased in leukocytes of patients with chronic heart failure at different stages of the disease.
23499766 2013 Plasma intermedin levels in patients with acute myocardial infarction.
23391507 2013 Increased plasma levels of intermedin and brain natriuretic peptide associated with severity of coronary stenosis in acute coronary syndrome.
More...