Property Summary

NCBI Gene PubMed Count 47
PubMed Score 325.54
PubTator Score 162.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Myocardial Ischemia 169 0.0 0.0
Vascular Diseases 16 0.0 0.0
Disease Target Count P-value
psoriasis 6694 1.2e-03
Disease Target Count Z-score Confidence
Influenza 142 4.137 2.1

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.100 1.2e-03

Gene RIF (33)

AA Sequence

MARIPTAALGCISLLCLQLPGSLSRSLGGDPRPVKPREPPARSPSSSLQPRHPAPRPVVWKLHRALQAQR      1 - 70
GAGLAPVMGQPLRDGGRQHSGPRRHSGPRRTQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVD     71 - 140
PSSPHSYG                                                                  141 - 148
//

Text Mined References (47)

PMID Year Title