Property Summary

NCBI Gene PubMed Count 6
PubMed Score 7.36
PubTator Score 2.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytoma -1.100 4.3e-02
ependymoma -1.200 2.7e-02
glioblastoma -1.200 3.3e-03
hereditary spastic paraplegia -1.106 1.9e-03
intraductal papillary-mucinous carcinoma... -1.100 6.2e-03
intraductal papillary-mucinous neoplasm ... -1.800 6.0e-04
lung cancer 2.400 8.5e-04
malignant mesothelioma -1.200 2.3e-05
Multiple myeloma 1.775 3.6e-03
ovarian cancer -2.500 4.0e-11

Synonym

Accession Q7Z4H3 Q5TDQ4 Q6NZ49 Q9BTT2 Q9BV31 Q9Y3D1
Symbols C6orf74
CGI-130
NS5ATP2
dJ167O5.2

Gene

PDB

4DMB   4L1J   4L7E   4L7W  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (2)

Gene RIF (2)

AA Sequence

MASVSSATFSGHGARSLLQFLRLVGQLKRVPRTGWVYRNVQRPESVSDHMYRMAVMAMVIKDDRLNKDRC      1 - 70
VRLALVHDMAECIVGDIAPADNIPKEEKHRREEEAMKQITQLLPEDLRKELYELWEEYETQSSAEAKFVK     71 - 140
QLDQCEMILQASEYEDLEHKPGRLQDFYDSTAGKFNHPEIVQLVSELEAERSTNIAAAASEPHS          141 - 204
//

Text Mined References (12)

PMID Year Title