Property Summary

NCBI Gene PubMed Count 6
PubMed Score 6.93
PubTator Score 2.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 1.98796490973956E-6
malignant mesothelioma 3163 2.25724823443343E-5
intraductal papillary-mucinous neoplasm (IPMN) 3289 5.99562830627818E-4
lung cancer 4473 8.54733806440779E-4
hereditary spastic paraplegia 313 0.0018985374509237
glioblastoma 5572 0.00329594490766539
Multiple myeloma 1328 0.00361316213599408
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00619481155634645
ependymoma 2514 0.0271611801494911
astrocytoma 1493 0.0426966359592264

Expression

  Differential Expression (10)

Disease log2 FC p
Multiple myeloma 1.775 0.004
malignant mesothelioma -1.200 0.000
ependymoma -1.200 0.027
astrocytoma -1.100 0.043
glioblastoma -1.200 0.003
hereditary spastic paraplegia -1.106 0.002
intraductal papillary-mucinous carcinoma... -1.100 0.006
intraductal papillary-mucinous neoplasm ... -1.800 0.001
lung cancer 2.400 0.001
ovarian cancer 2.700 0.000

Synonym

Accession Q7Z4H3 Q5TDQ4 Q6NZ49 Q9BTT2 Q9BV31 Q9Y3D1
Symbols C6orf74
CGI-130
NS5ATP2
dJ167O5.2

Gene

PDB

4DMB   4L1J   4L7E   4L7W  

  Ortholog (17)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA EggNOG
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA Inparanoid

Gene RIF (2)

PMID Text
22190034 HIV-1 IN is identified to have a physical interaction with HD domain containing 2 (HDDC2) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MASVSSATFSGHGARSLLQFLRLVGQLKRVPRTGWVYRNVQRPESVSDHMYRMAVMAMVIKDDRLNKDRC      1 - 70
VRLALVHDMAECIVGDIAPADNIPKEEKHRREEEAMKQITQLLPEDLRKELYELWEEYETQSSAEAKFVK     71 - 140
QLDQCEMILQASEYEDLEHKPGRLQDFYDSTAGKFNHPEIVQLVSELEAERSTNIAAAASEPHS          141 - 204
//

Text Mined References (12)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22190034 2011 Global landscape of HIV-human protein complexes.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15188496 2004 Cloning and identification of NS5ATP2 gene and its spliced variant transactivated by hepatitis C virus non-structural protein 5A.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
More...