Property Summary

NCBI Gene PubMed Count 6
PubMed Score 6.93
PubTator Score 2.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Multiple myeloma 1.775 0.004
malignant mesothelioma -1.200 0.000
ependymoma -1.200 0.027
astrocytoma -1.100 0.043
glioblastoma -1.200 0.003
hereditary spastic paraplegia -1.106 0.002
intraductal papillary-mucinous carcinoma... -1.100 0.006
intraductal papillary-mucinous neoplasm ... -1.800 0.001
lung cancer 2.400 0.001
ovarian cancer 2.700 0.000

Gene RIF (2)

PMID Text
22190034 HIV-1 IN is identified to have a physical interaction with HD domain containing 2 (HDDC2) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MASVSSATFSGHGARSLLQFLRLVGQLKRVPRTGWVYRNVQRPESVSDHMYRMAVMAMVIKDDRLNKDRC      1 - 70
VRLALVHDMAECIVGDIAPADNIPKEEKHRREEEAMKQITQLLPEDLRKELYELWEEYETQSSAEAKFVK     71 - 140
QLDQCEMILQASEYEDLEHKPGRLQDFYDSTAGKFNHPEIVQLVSELEAERSTNIAAAASEPHS          141 - 204
//

Text Mined References (12)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22190034 2011 Global landscape of HIV-human protein complexes.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15188496 2004 Cloning and identification of NS5ATP2 gene and its spliced variant transactivated by hepatitis C virus non-structural protein 5A.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
More...