Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.82
PubTator Score 2.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8519 2.1e-04

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer -1.300 2.1e-04

Gene RIF (1)

AA Sequence

MALSCTLNRYLLLMAQEHLEFRLPEIKSLLLLFGGQFASSQETYGKSPFWILSIPSEDIARNLMKRTVCA      1 - 70
KSIFELWGHGQSPEELYSSLKNYPVEKMVPFLHSDSTYKIKIHTFNKTLTQEEKIKRIDALEFLPFEGKV     71 - 140
NLKKPQHVFSVLEDYGLDPNCIPENPHNIYFGRWIADGQRELIESYSVKKRHFIGNTSMDAGLSFIMANH    141 - 210
GKVKENDIVFDPFVGTGGLLIACAHFGAYVYGTDIDYNTVHGLGKATRKNQKWRGPDENIRANLRQYGLE    211 - 280
KYYLDVLVSDASKPSWRKGTYFDAIITDPPYGIRESTRRTGSQKEIPKGIEKWEKCPESHVPVSLSYHLS    281 - 350
DMFLDLLNFAAETLVLGGRLVYWLPVYTPEYTEEMVPWHPCLELVSNCEQKLSSHTSRRLITMEKVKKFE    351 - 420
NRDQYSHLLSDHFLPYQGHNSFREKYFSGVTKRIAKEEKSTQE                               421 - 463
//

Text Mined References (10)

PMID Year Title