Property Summary

NCBI Gene PubMed Count 15
PubMed Score 3.83
PubTator Score 3.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytoma 2.400 2.9e-03
Astrocytoma, Pilocytic 1.500 2.4e-08
Down syndrome 1.200 2.7e-03
ependymoma 1.300 2.9e-02
glioblastoma 1.700 2.7e-02
group 4 medulloblastoma -1.100 2.2e-03
intraductal papillary-mucinous carcinoma... 1.100 4.4e-03
intraductal papillary-mucinous neoplasm ... 1.300 3.0e-03
malignant mesothelioma -2.100 7.4e-08
medulloblastoma, large-cell -1.200 5.7e-04
mucosa-associated lymphoid tissue lympho... 1.062 8.1e-03
Multiple myeloma 1.204 2.8e-04
nasopharyngeal carcinoma -1.100 1.9e-05
osteosarcoma -1.759 7.2e-07
ovarian cancer -1.400 1.4e-07
pediatric high grade glioma 1.300 2.2e-05
psoriasis 1.300 1.3e-04
spina bifida -1.500 3.5e-02
subependymal giant cell astrocytoma 1.716 1.1e-02

Gene RIF (3)

AA Sequence

MLLATLLLLLLGGALAHPDRIIFPNHACEDPPAVLLEVQGTLQRPLVRDSRTSPANCTWLILGSKEQTVT      1 - 70
IRFQKLHLACGSERLTLRSPLQPLISLCEAPPSPLQLPGGNVTITYSYAGARAPMGQGFLLSYSQDWLMC     71 - 140
LQEEFQCLNHRCVSAVQRCDGVDACGDGSDEAGCSSDPFPGLTPRPVPSLPCNVTLEDFYGVFSSPGYTH    141 - 210
LASVSHPQSCHWLLDPHDGRRLAVRFTALDLGFGDAVHVYDGPGPPESSRLLRSLTHFSNGKAVTVETLS    211 - 280
GQAVVSYHTVAWSNGRGFNATYHVRGYCLPWDRPCGLGSGLGAGEGLGERCYSEAQRCDGSWDCADGTDE    281 - 350
EDCPGCPPGHFPCGAAGTSGATACYLPADRCNYQTFCADGADERRCRHCQPGNFRCRDEKCVYETWVCDG    351 - 420
QPDCADGSDEWDCSYVLPRKVITAAVIGSLVCGLLLVIALGCTCKLYAIRTQEYSIFAPLSRMEAEIVQQ    421 - 490
QAPPSYGQLIAQGAIPPVEDFPTENPNDNSVLGNLRSLLQILRQDMTPGGGPGARRRQRGRLMRRLVRRL    491 - 560
RRWGLLPRTNTPARASEARSQVTPSAAPLEALDGGTGPAREGGAVGGQDGEQAPPLPIKAPLPSASTSPA    561 - 630
PTTVPEAPGPLPSLPLEPSLLSGVVQALRGRLLPSLGPPGPTRSPPGPHTAVLALEDEDDVLLVPLAEPG    631 - 700
VWVAEAEDEPLLT                                                             701 - 713
//

Text Mined References (20)

PMID Year Title