Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q7Z4B0 Q8NHR5
Symbols HsT1235
C18orf20
NCRNA00305

Gene

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MINLHRLCIIHVVATLLSTLLSLISVAISATCKDEKGKQEMETGQQPSGLSATLTKVKCAKRQKTVVRVR      1 - 70
FYMLSMKNKACRKNLSKGYNQRPEGSKEESHMVVKEKRKGDH                                 71 - 112
//

Text Mined References (3)

PMID Year Title
16177791 2005 DNA sequence and analysis of human chromosome 18.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.