Property Summary

NCBI Gene PubMed Count 31
PubMed Score 32.42
PubTator Score 29.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (15)

Disease log2 FC p
acute quadriplegic myopathy 1.250 2.1e-06
adult high grade glioma 1.200 1.2e-02
astrocytic glioma 1.400 2.8e-02
Astrocytoma, Pilocytic 1.600 1.7e-06
atypical teratoid / rhabdoid tumor 1.200 3.3e-04
breast carcinoma -1.100 7.7e-25
ependymoma 1.300 2.5e-05
glioblastoma 1.400 9.6e-06
invasive ductal carcinoma -1.300 2.8e-03
non primary Sjogren syndrome sicca -1.100 2.6e-02
osteosarcoma 2.213 1.1e-05
ovarian cancer -2.400 1.0e-12
Pick disease -2.200 7.2e-05
primitive neuroectodermal tumor 1.400 1.6e-05
progressive supranuclear palsy -2.200 1.2e-02

 GO Component (2)

Protein-protein Interaction (3)

Gene RIF (12)

AA Sequence

MGTASSLVSPAGGEVIEDTYGAGGGEACEIPVEVKPKARLLRNSFRRGAGAAAGAGPGSLPRGVGAGGLL      1 - 70
GASFKSTGSSVPELEYAAAEYERLRKEYEIFRVSKNQELLSMGRREAKLDTENKRLRAELQALQKTYQKI     71 - 140
LREKESALEAKYQAMERAATFEHDRDKVKRQFKIFRETKENEIQDLLRAKRELESKLQRLQAQGIQVFDP    141 - 210
GESDSDDNCTDVTAAGTQCEYWTGGALGSEPSIGSMIQLQQSFRGPEFAHSSIDVEGPFANVNRDDWDIA    211 - 280
VASLLQVTPLFSHSLWSNTVRCYLIYTDETQPEMDLFLKDYSPKLKRMCETMGYFFHAVYFPIDVENQYL    281 - 350
TVRKWEIEKSSLVILFIHLTLPSLLLEDCEEAFLKNPEGKPRLIFHRLEDGKVSSDSVQQLIDQVSNLNK    351 - 420
TSKAKIIDHSGDPAEGVYKTYICVEKIIKQDILGFENTDLETKDLGSEDSIPEEDDFGDVLWDIHDEQEQ    421 - 490
METFQQASNSAHELGFEKYYQRLNDLVAAPAPIPPLLVSGGPGSGKSLLLSKWIQLQQKNSPNTLILSHF    491 - 560
VGRPMSTSSESSLIIKRLTLKLMQHSWSVSALTLDPAKLLEEFPRWLEKLSARHQGSIIIVIDSIDQVQQ    561 - 630
VEKHMKWLIDPLPVNVRVIVSVNVETCPPAWRLWPTLHLDPLSPKDAKSIIIAECHSVDIKLSKEQEKKL    631 - 700
ERHCRSATTCNALYVTLFGKMIARAGRAGNLDKILHQCFQCQDTLSLYRLVLHSIRESMANDVDKELMKQ    701 - 770
ILCLVNVSHNGVSESELMELYPEMSWTFLTSLIHSLYKMCLLTYGCGLLRFQHLQAWETVRLEYLEGPTV    771 - 840
TSSYRQKLINYFTLQLSQDRVTWRSADELPWLFQQQGSKQKLHDCLLNLFVSQNLYKRGHFAELLSYWQF    841 - 910
VGKDKSAMATEYFDSLKQYEKNCEGEDNMSCLADLYETLGRFLKDLGLLSQAIVPLQRSLEIRETALDPD    911 - 980
HPRVAQSLHQLASVYVQWKKFGNAEQLYKQALEISENAYGADHPYTARELEALATLYQKQNKYEQAEHFR    981 - 1050
KKSFKIHQKAIKKKGNLYGFALLRRRALQLEELTLGKDTPDNARTLNELGVLYYLQNNLETADQFLKRSL   1051 - 1120
EMRERVLGPDHPDCAQSLNNLAALCNEKKQYDKAEELYERALDIRRRALAPDHPSLAYTVKHLAILYKKM   1121 - 1190
GKLDKAVPLYELAVEIRQKSFGPKHPSVATALVNLAVLYSQMKKHVEALPLYERALKIYEDSLGRMHPRV   1191 - 1260
GETLKNLAVLSYEGGDFEKAAELYKRAMEIKEAETSLLGGKAPSRHSSSGDTFSLKTAHSPNVFLQQGQR   1261 - 1330
//

Text Mined References (30)

PMID Year Title