Property Summary

NCBI Gene PubMed Count 16
Grant Count 9
R01 Count 9
Funding $590,303.6
PubMed Score 9.48
PubTator Score 12.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.391 0.000
diabetes mellitus -1.100 0.001
group 3 medulloblastoma 1.100 0.003
ovarian cancer 2.500 0.000
dermatomyositis 1.600 0.001

 GO Process (1)

Gene RIF (5)

PMID Text
24821782 Helicase proteins DHX29 and RIG-I cosense cytosolic nucleic acids in the human airway system.
23047696 Roles of individual domains in the function of DHX29, an essential factor required for translation of structured mammalian mRNAs.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20018725 Down-regulation of DHX29 leads to impaired translation, resulting in disassembly of polysomes and accumulation of mRNA-free 80S monomers. DHX29 depletion also impedes cancer cell growth in culture and in xenografts.
19109895 Study reports that these 7 eIFs are not sufficient for efficient 48S complex formation on mRNAs with highly structured 5'UTRs, and that this process requires the DExH-box protein DHX29.

AA Sequence

MGGKNKKHKAPAAAVVRAAVSASRAKSAEAGIAGEAQSKKPVSRPATAAAAAAGSREPRVKQGPKIYSFN      1 - 70
STNDSSGPANLDKSILKVVINNKLEQRIIGVINEHKKQNNDKGMISGRLTAKKLQDLYMALQAFSFKTKD     71 - 140
IEDAMTNTLLYGGDLHSALDWLCLNLSDDALPEGFSQEFEEQQPKSRPKFQSPQIQATISPPLQPKTKTY    141 - 210
EEDPKSKPKKEEKNMEVNMKEWILRYAEQQNEEEKNENSKSLEEEEKFDPNERYLHLAAKLLDAKEQAAT    211 - 280
FKLEKNKQGQKEAQEKIRKFQREMETLEDHPVFNPAMKISHQQNERKKPPVATEGESALNFNLFEKSAAA    281 - 350
TEEEKDKKKEPHDVRNFDYTARSWTGKSPKQFLIDWVRKNLPKSPNPSFEKVPVGRYWKCRVRVIKSEDD    351 - 420
VLVVCPTILTEDGMQAQHLGATLALYRLVKGQSVHQLLPPTYRDVWLEWSDAEKKREELNKMETNKPRDL    421 - 490
FIAKLLNKLKQQQQQQQQHSENKRENSEDPEESWENLVSDEDFSALSLESANVEDLEPVRNLFRKLQSTP    491 - 560
KYQKLLKERQQLPVFKHRDSIVETLKRHRVVVVAGETGSGKSTQVPHFLLEDLLLNEWEASKCNIVCTQP    561 - 630
RRISAVSLANRVCDELGCENGPGGRNSLCGYQIRMESRACESTRLLYCTTGVLLRKLQEDGLLSNVSHVI    631 - 700
VDEVHERSVQSDFLLIILKEILQKRSDLHLILMSATVDSEKFSTYFTHCPILRISGRSYPVEVFHLEDII    701 - 770
EETGFVLEKDSEYCQKFLEEEEEVTINVTSKAGGIKKYQEYIPVQTGAHADLNPFYQKYSSRTQHAILYM    771 - 840
NPHKINLDLILELLAYLDKSPQFRNIEGAVLIFLPGLAHIQQLYDLLSNDRRFYSERYKVIALHSILSTQ    841 - 910
DQAAAFTLPPPGVRKIVLATNIAETGITIPDVVFVIDTGRTKENKYHESSQMSSLVETFVSKASALQRQG    911 - 980
RAGRVRDGFCFRMYTRERFEGFMDYSVPEILRVPLEELCLHIMKCNLGSPEDFLSKALDPPQLQVISNAM    981 - 1050
NLLRKIGACELNEPKLTPLGQHLAALPVNVKIGKMLIFGAIFGCLDPVATLAAVMTEKSPFTTPIGRKDE   1051 - 1120
ADLAKSALAMADSDHLTIYNAYLGWKKARQEGGYRSEITYCRRNFLNRTSLLTLEDVKQELIKLVKAAGF   1121 - 1190
SSSTTSTSWEGNRASQTLSFQEIALLKAVLVAGLYDNVGKIIYTKSVDVTEKLACIVETAQGKAQVHPSS   1191 - 1260
VNRDLQTHGWLLYQEKIRYARVYLRETTLITPFPVLLFGGDIEVQHRERLLSIDGWIYFQAPVKIAVIFK   1261 - 1330
QLRVLIDSVLRKKLENPKMSLENDKILQIITELIKTENN                                  1331 - 1369
//

Text Mined References (24)

PMID Year Title
27067542 2016 DHX29 reduces leaky scanning through an upstream AUG codon regardless of its nucleotide context.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24821782 2014 Helicase proteins DHX29 and RIG-I cosense cytosolic nucleic acids in the human airway system.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23706745 2013 Structure of the mammalian ribosomal 43S preinitiation complex bound to the scanning factor DHX29.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23047696 2012 Roles of individual domains in the function of DHX29, an essential factor required for translation of structured mammalian mRNAs.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...