Property Summary

NCBI Gene PubMed Count 18
PubMed Score 1962.01
PubTator Score 118.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.800 1.3e-05

Gene RIF (16)

AA Sequence

MELPTKPGTFDLGLATWSPSFQGETHRAQARRRDVGRQLPEYKAVVVGASGVGKSALTIQLNHQCFVEDH      1 - 70
DPTIQDSYWKELTLDSGDCILNVLDTAGQAIHRALRDQCLAVCDGVLGVFALDDPSSLIQLQQIWATWGP     71 - 140
HPAQPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVETSAKTRQGVEEAFSLLVHEIQRVQEAMAKEP    141 - 210
MARSCREKTRHQKATCHCGCSVA                                                   211 - 233
//

Text Mined References (18)

PMID Year Title