Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.27
PubTator Score 2.18

Knowledge Summary

Patent (309)

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 8.3060764988572E-10
breast carcinoma 1614 3.81219384202857E-4
Atopic dermatitis 944 5.86748671985623E-4
posterior fossa group B ependymoma 1530 8.17458804502265E-4
ductal carcinoma in situ 1745 0.00309020977794107
invasive ductal carcinoma 2950 0.0190404055461112
fibroadenoma 557 0.0255076124990979
Disease Target Count Z-score Confidence
Polycystic kidney disease 54 3.854 1.9
Ameloblastoma 25 3.303 1.7

Expression

  Differential Expression (7)

Disease log2 FC p
Atopic dermatitis -1.800 0.001
breast carcinoma -1.300 0.000
fibroadenoma -1.500 0.026
posterior fossa group B ependymoma 1.700 0.001
ductal carcinoma in situ -2.300 0.003
invasive ductal carcinoma -2.400 0.019
ovarian cancer -1.700 0.000

Synonym

Accession Q7Z442 Q6UEE1 Q6ZN46 Q6ZSP2 Q8N1H9 Q96CL2 Q96Q08
Symbols PC1L2

Gene

  Ortholog (5)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Dog OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (5)

PMID Text
19844255 Observational study of gene-disease association. (HuGE Navigator)
19578180 Ectopic expression of PKD1L2 in transgenic mice caused severe muscle atrophy.
18187620 Knockdown of polycystic kidney disease 1-like 2 (PKD1L2) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
15203210 PKD1L2 is expressed in the developing and adult heart and kidney.
12782129 genes are mapped to chromosomes and gene structures are characterized; protein structure is predicted and contains strong ion channel signature motifs that suggest their possible function as components of cation channel pores

AA Sequence

MSAVGLVLLVLALRLRATTVKPEEGSFCSNSQVAFRDACYEFVPLGRTFRDAQSWCEGQGGHLVFIQDEG      1 - 70
TQWFLQKHISQDREWWIGLTWNLARNGTTEGPGTWLDTSNVTYSNWHGGQAAAAPDTCGHIGRGPSSEWV     71 - 140
TSDCAQTFAFMCEFRVGQSLACEGLNATVHCGLGQVIQVQDAVYGRQNPHFCTQDAGRPSDLEQGCSWAN    141 - 210
VKEEVAGQCQELQSCQVAADETYFGNLCPTQGSYLWVQYQCREALQLMVSSESFIFDNVTISLTWLLSPY    211 - 280
IGNLSCIISTGDSHTFDPYNPPSVSSNVTHQFTSPGEFTVFAECTTSEWHVTAQRQVTVRDKMETLSVTA    281 - 350
CSGLSQSGAGPLCQAVFGDPLWIQVELDGGTGVTYTVLLGDITLAESTTQKGSLPYNLILDRETQKLMGP    351 - 420
GRHRLEIQATGNTTTSTISRNITVHLVELLSGLQASWASDHLELGQDLLITISLAQGTPEELTFEVAGLN    421 - 490
ATFSHEQVSFGEPFGICRLAVPVEGTFLVTMLVRNAFSNLSLEIGNITITAPSGLQEPSGMNAEGKSKDK    491 - 560
GDMEVYIQPGPYVDPFTTVTLGWPDNDKELRFQWSCGSCWALWSSCVERQLLRTDQRELVVPASCLPPPD    561 - 630
SAVTLRLAVLRGQELENRAEQCLYVSAPWELRPRVSCERNCRPVNASKDILLRVTMGEDSPVAMFSWYLD    631 - 700
NTPTEQAEPLLDACRLRGFWPRSLTLLQSNTSTLLLNSSFLQSRGEVIRIRATALTRHAYGEDTYVISTV    701 - 770
PPREVPACTIAPEEGTVLTSFAIFCNASTALGPLEFCFCLESGSCLHCGPEPALPSVYLPLGEENNDFVL    771 - 840
TVVISATNRAGDTQQTQAMAKVALGDTCVEDVAFQAAVSEKIPTALQGEGGPEQLLQLAKAVSSMLNQEH    841 - 910
ESQGSGQSLSIDVRQKVREHVLGSLSAVTTGLEDVQRVQELAEVLREVTCRSKELTPSAQWEASLALQHA    911 - 980
SEALLTVSAKARPEDQRRQAATRDLFQAVGSVLEASLSNRPEEPAEASSSQIATVLRLLRVMEHVQTTLL    981 - 1050
LGKLPGGLPAMLATPSISVYTNRIQPWSWQGSSLRPDAADSATFMLPAASSLSSLEGGQEPVDIKIMSFP   1051 - 1120
KSPFPARSHFDVSGTVGGLRVTSPSGQLIPVKNLSENIEILLPRHSQRHSQPTVLNLTSPEALWVNVTSG   1121 - 1190
EATLGIQLHWRPDIALTLSLGYGYHPNKSSYDAQTHLVPMVAPDELPTWILSPQDLRFGEGVYYLTVVPE   1191 - 1260
SDLEPAPGRDLTVGITTFLSHCVFWDEVQETWDDSGCQVGPRTSPYQTHCLCNHLTFFGSTFLVMSNAIN   1261 - 1330
IHQTAELFATFEDNPVVVTTVGCLCVVYVLVVIWARRKDAQDQAKVKVTVLEDNDPFAQYHYLVTVYTGH   1331 - 1400
RRGAATSSKVTVTLYGLDGEREPHHLADPDTPVFERGAVDAFLLSTLFPLGELRSLRLWHDNSGDRPSWY   1401 - 1470
VSRVLVYDLVMDRKWYFLCNSWLSINVGDCVLDKVFPVATEQDRKQFSHLFFMKTSAGFQDGHIWYSIFS   1471 - 1540
RCARSSFTRVQRVSCCFSLLLCTMLTSIMFWGVPKDPAEQKMDLGKIEFTWQEVMIGLESSILMFPINLL   1541 - 1610
IVQIFQNTRPRVAKEQNTGKWDRGSPNLTPSPQPMEDGLLTPEAVTKDVSRIVSSLFKALKVPSPALGWD   1611 - 1680
SVNLMDINSLLALVEDVIYPQNTSGQVFWEEAKKREDPVTLTLGSSEMKEKSQCPKPKAARSGPWKDSAY   1681 - 1750
RQCLYLQLEHVEQELRLVGPRGFSQPHSHAQALRQLQTLKGGLGVQPGTWAPAHASALQVSKPPQGLPWW   1751 - 1820
CILVGWLLVAATSGVAAFFTMLYGLHYGRASSLRWLISMAVSFVESMFVTQPLKVLGFAAFFALVLKRVD   1821 - 1890
DEEDTVAPLPGHLLGPDPYALFRARRNSSRDVYQPPLTAAIEKMKTTHLKEQKAFALIREILAYLGFLWM   1891 - 1960
LLLVAYGQRDPSAYHLNRHLQHSFTRGFSGVLGFREFFKWANTTLVSNLYGHPPGFITDGNSKLVGSAQI   1961 - 2030
RQVRVQESSCPLAQQPQAYLNGCRAPYSLDAEDMADYGEGWNATTLSEWQYQSQDQRQGYPIWGKLTVYR   2031 - 2100
GGGYVVPLGTDRQKHVKILRYLFDNTWLDALTRAVFVESTVYNANVNLFCIVTLTLETSALGTFFTHAAL   2101 - 2170
QSLRLYPFTDGWHPFVVAAELIYFLFLLYYMVVQGKRMSKETWGYFCSKWNLLELAIILASWSALAVFVK   2171 - 2240
RAVLAERDLQRCRNHREEGISFSETAAADAALGYIIAFLVLLSTVKLWHLLRLNPKMNMITAALRRAWGD   2241 - 2310
ISGFMIVILTMLLAYSIASNLIFGWKLRSYKTLFDAAETMVSLQLGIFNYEEVLDYSPVLGSFLIGSCIV   2311 - 2380
FMTFVVLNLFISVILVAFSEEQKYYQLSEEGEIVDLLLMKILSFLGIKSKREEPGSSREQPGSLSQTRHS   2381 - 2450
RPAQALPKD                                                                2451 - 2459
//

Text Mined References (13)

PMID Year Title
24756726 2014 The TRPP subfamily and polycystin-1 proteins.
24336289 2013 Direct recording and molecular identification of the calcium channel of primary cilia.
19844255 2010 Fine mapping and association studies of a high-density lipoprotein cholesterol linkage region on chromosome 16 in French-Canadian subjects.
19578180 2009 Upregulation of PKD1L2 provokes a complex neuromuscular disease in the mouse.
18951430 2008 Conduct disorder and ADHD: evaluation of conduct problems as a categorical and quantitative trait in the international multicentre ADHD genetics study.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15203210 2004 Polycystin-1L2 is a novel G-protein-binding protein.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...