Property Summary

NCBI Gene PubMed Count 167
PubMed Score 413.54
PubTator Score 360.25

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma 1.100 6.5e-03
cystic fibrosis and chronic rhinosinusit... 1.248 2.0e-02
ependymoma 1.200 8.2e-03
Gaucher disease type 1 -1.200 3.9e-02
glioblastoma multiforme 1.100 3.2e-21
oligodendroglioma 1.200 3.3e-03
osteosarcoma -2.034 1.4e-06
Pick disease 1.500 2.7e-05
psoriasis -1.300 7.1e-04
ulcerative colitis -1.200 2.4e-06

Protein-protein Interaction (1)

Gene RIF (125)

AA Sequence

MPFAEDKTYKYICRNFSNFCNVDVVEILPYLPCLTARDQDRLRATCTLSGNRDTLWHLFNTLQRRPGWVE      1 - 70
YFIAALRGCELVDLADEVASVYQSYQPRTSDRPPDPLEPPSLPAERPGPPTPAAAHSIPYNSCREKEPSY     71 - 140
PMPVQETQAPESPGENSEQALQTLSPRAIPRNPDGGPLESSSDLAALSPLTSSGHQEQDTELGSTHTAGA    141 - 210
TSSLTPSRGPVSPSVSFQPLARSTPRASRLPGPTGSVVSTGTSFSSSSPGLASAGAAEGKQGAESDQAEP    211 - 280
IICSSGAEAPANSLPSKVPTTLMPVNTVALKVPANPASVSTVPSKLPTSSKPPGAVPSNALTNPAPSKLP    281 - 350
INSTRAGMVPSKVPTSMVLTKVSASTVPTDGSSRNEETPAAPTPAGATGGSSAWLDSSSENRGLGSELSK    351 - 420
PGVLASQVDSPFSGCFEDLAISASTSLGMGPCHGPEENEYKSEGTFGIHVAENPSIQLLEGNPGPPADPD    421 - 490
GGPRPQADRKFQEREVPCHRPSPGALWLQVAVTGVLVVTLLVVLYRRRLH                        491 - 540
//

Text Mined References (185)

PMID Year Title