Property Summary

NCBI Gene PubMed Count 147
Grant Count 105
R01 Count 42
Funding $10,049,349.72
PubMed Score 366.50
PubTator Score 360.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma 1.100 0.006
ependymoma 1.200 0.008
oligodendroglioma 1.200 0.003
psoriasis -1.300 0.001
glioblastoma multiforme 1.100 0.000
osteosarcoma 2.284 0.000
Pick disease 1.500 0.000
ulcerative colitis -1.200 0.000
Gaucher disease type 1 -1.200 0.039
cystic fibrosis and chronic rhinosinusit... 1.248 0.020

Synonym

Gene

PDB

4Z8M   4P4H   2MS7   2MS8   2VGQ   3J6C   3J6J   3RC5   5JEK  

Gene RIF (109)

PMID Text
26998762 Data show that the NS3 protein of dengue virus bound to 14-3-3 epsilon protein (14-3-3varepsilon) and prevented translocation of retinoic acid-inducible gene-I protein (RIG-I) to the adaptor MAVS protein and thereby blocked antiviral signaling.
26954674 This study identified new functional alterations in antiviral signalling based on MAVS polymorphisms
26646717 Using bone marrow derived macrophages from knockout mice we demonstrate that hBD3 suppresses the polyI:C-induced TLR3 response mediated by TICAM1 (TRIF), while exacerbating the cytoplasmic response through MDA5 (IFIH1) and MAVS (IPS1/CARDIF).
26588843 indicate comparable activation of the IFN response by pex- and mito-mitochondrial antiviral-signaling protein in hepatocytes and efficient counteraction of both MAVS species by the HCV nonstructural protein 3 protease
26512076 These results suggest that vIRF-1 is the first example of a viral protein to inhibit mitochondrial antiviral signaling through lipid raft-like microdomains.
26437794 These results demonstrate that poliovirus infection actively suppresses the host type I interferon response by blocking activation of IRF-3 and suggests that this is not mediated by cleavage of MDA-5 or IPS-1.
26385923 Transmembrane motif T6BM2-mediated TRAF6 binding is required for MAVS-related antiviral response.
26375588 HIV-1 Nef (NL4-3) degrades (leads to degradation of) MAVS
26375588 HIV-1 Nef (NL4-3) degrades (leads to degradation of) MAVS
26375588 HIV-1 Nef (NL4-3) degrades (leads to degradation of) MAVS
More...

AA Sequence

MPFAEDKTYKYICRNFSNFCNVDVVEILPYLPCLTARDQDRLRATCTLSGNRDTLWHLFNTLQRRPGWVE      1 - 70
YFIAALRGCELVDLADEVASVYQSYQPRTSDRPPDPLEPPSLPAERPGPPTPAAAHSIPYNSCREKEPSY     71 - 140
PMPVQETQAPESPGENSEQALQTLSPRAIPRNPDGGPLESSSDLAALSPLTSSGHQEQDTELGSTHTAGA    141 - 210
TSSLTPSRGPVSPSVSFQPLARSTPRASRLPGPTGSVVSTGTSFSSSSPGLASAGAAEGKQGAESDQAEP    211 - 280
IICSSGAEAPANSLPSKVPTTLMPVNTVALKVPANPASVSTVPSKLPTSSKPPGAVPSNALTNPAPSKLP    281 - 350
INSTRAGMVPSKVPTSMVLTKVSASTVPTDGSSRNEETPAAPTPAGATGGSSAWLDSSSENRGLGSELSK    351 - 420
PGVLASQVDSPFSGCFEDLAISASTSLGMGPCHGPEENEYKSEGTFGIHVAENPSIQLLEGNPGPPADPD    421 - 490
GGPRPQADRKFQEREVPCHRPSPGALWLQVAVTGVLVVTLLVVLYRRRLH                        491 - 540
//

Text Mined References (163)

PMID Year Title
26998762 2016 A phosphomimetic-based mechanism of dengue virus to antagonize innate immunity.
26954674 2016 Alteration of Antiviral Signalling by Single Nucleotide Polymorphisms (SNPs) of Mitochondrial Antiviral Signalling Protein (MAVS).
26646717 2015 Human ?-Defensin 3 [corrected] Exacerbates MDA5 but Suppresses TLR3 Responses to the Viral Molecular Pattern Mimic Polyinosinic:Polycytidylic Acid.
26588843 2015 Activation of Type I and III Interferon Response by Mitochondrial and Peroxisomal MAVS and Inhibition by Hepatitis C Virus.
26512076 2015 Modulation of Mitochondrial Antiviral Signaling by Human Herpesvirus 8 Interferon Regulatory Factor 1.
26437794 2015 Proteolysis of MDA5 and IPS-1 is not required for inhibition of the type I IFN response by poliovirus.
26385923 2015 Structural Insights into mitochondrial antiviral signaling protein (MAVS)-tumor necrosis factor receptor-associated factor 6 (TRAF6) signaling.
26317833 2015 Modulation of Innate Immune Signalling by Lipid-Mediated MAVS Transmembrane Domain Oligomerization.
26246171 2015 The mitochondrial ubiquitin ligase MARCH5 resolves MAVS aggregates during antiviral signalling.
26223644 2015 RIG-I Mediates an Antiviral Response to Crimean-Congo Hemorrhagic Fever Virus.
More...